The 2019 novel coronavirus, or "SARS-CoV-2", was discovered because of Wuhan virus pneumonia cases in 2019, and was named by the World Health Organization on January 12, 2020. It belongs to the beta genera of the Coronaviridae family, together with SARS coronavirus in 2003 and MERS coronavirus in 2012. The alignment between SARS-CoV-2 and 2003 SARS CoV has about 70% sequence similarity and 40% sequence similarity with MERS CoV. The coronavirus genome encodes a spike protein, an envelope protein, a membrane protein, and a nucleoprotein. Among them, spike protein is the most important surface membrane protein of coronavirus.

CAT# Product Name Product Overview Source Data sheet SIZE PRICE Add to basket
VReP-Wyb042 Recombinant SARS-CoV-2 S Protein (aa 16-1213) [His] SARS-CoV-2, Recombinant Protein, Spike Protein (R683A, R685A) [His]. HEK293 Cells 100 µg $1128.00
VReP-Wyb043 Recombinant SARS-CoV-2 S1 Protein (aa 16-685) [His] SARS-CoV-2, Recombinant Protein, Subunit 1 of Spike Protein [His]. HEK293 Cells 100 µg $893.00
VReP-Wyb044 Recombinant SARS-CoV-2 S1 Protein (aa 16-685) [His-Avi] SARS-CoV-2, Recombinant Protein, Subunit 1 of Spike Protein [His-Avi]. HEK293 Cells 25 µg $893.00
VReP-Wyb048 Recombinant SARS-CoV-2 S Protein (aa 319-541) [His-Avi] SARS-CoV-2, Recombinant Protein, RBD of Spike Protein [His-Avi]. HEK293 Cells 25 µg $893.00
VReP-Wyb049 Recombinant SARS-CoV-2 S Protein (aa 319-541) [Fc] SARS-CoV-2, Recombinant Protein, RBD of Spike Protein [Fc]. HEK293 Cells 100 µg $893.00
VReP-Wyb051 Recombinant SARS-CoV-2 3CL-Mpro Protein (aa 1-306) [His] SARS-CoV-2, Recombinant Protein, 3C-like main protease Protein [His]. E. coli 100 µg $823.00
VReP-Wyb052 Recombinant SARS-CoV-2 N Protein (aa 1-419) [His] SARS-CoV-2, Recombinant Protein, Nucleocapsid Protein [His]. E. coli 100 µg $940.00
VReP-Wyb053 Recombinant SARS-CoV-2 Env Protein (aa 1-75) [His] SARS-CoV-2, Recombinant Protein, Envelope Protein [His]. E. coli 100 µg $823.00
VReP-Wyb057 Recombinant SARS-CoV-2 RBD of S Protein (aa 319-541) [His] (Baculovirus-Insect Cells) SARS-CoV-2 (2019-nCoV), Recombinant Protein, RBD of Spike Protein with His tag at the C-terminus. (YP_009724390.1) Baculovirus-Insect Cells 100 µg $978.00
VReP-Wyb058 Recombinant SARS-CoV-2 RBD of S Protein [Fc] SARS-CoV-2 (2019-nCoV), Recombinant Protein, RBD of Spike Protein [Fc]. HEK293 Cells 100 µg $978.00
VReP-Wyb059 Recombinant SARS-CoV-2 RBD of S Protein (234 aa) [His] SARS-CoV-2 (2019-nCoV), Recombinant Protein, RBD of Spike Protein (aa 319-541) with His tag at the C-terminus. (YP_009724390.1) HEK293 Cells 100 µg $978.00
VReP-Wyb068 Recombinant SARS-CoV-2 NP Protein (418 aa) SARS-CoV-2 (2019-nCoV), Recombinant Protein, Nucleocapsid Protein (418 aa). E. coli Inquiry
VReP-Wyb069 Recombinant SARS-CoV-2 RBD of S1 Protein (194 aa) SARS-CoV-2 (2019-nCoV), Recombinant Protein, RBD of S1 Subunit of Spike Protein (194 aa). E. coli Inquiry
VReP-Wyb070 Recombinant SARS-CoV-2 RBD of S Protein [His] (Sf9 Insect Cells) SARS-CoV-2 (2019-nCoV), Recombinant Protein, RBD of Spike Protein. Sf9 Insect Cells 500 µg $2820.00
VReP-Wyb071 Recombinant SARS-CoV-2 N Protein [His] SARS-CoV-2 (2019-nCoV), Recombinant Protein, Nucleocapsid Protein. E. coli 100 µg $893.00
VReP-Wyb072 Recombinant SARS-CoV-2 ECD of S Protein [His-Fc] SARS-CoV-2 (2019-nCoV), Recombinant Protein, ECD of Spike Protein. Sf9 Insect Cells 100 µg $893.00
VReP-Wyb073 Recombinant SARS-CoV-2 RBD of S Protein [His] SARS-CoV-2 (2019-nCoV), Recombinant Protein, RBD of Spike Protein. Human Cells 100 µg $893.00
VReP-Wyb159 Recombinant SARS-COV-2 NSP1 Protein (aa 1-180) [His] SARS-COV-2, Recombinant Protein, Non-structural protein 1 Protein [His]. E. coli 100 µg $940.00
VReP-Wyb160 Recombinant SARS-COV-2 NSP7 Protein (aa 1-83) [His] SARS-COV-2, Recombinant Protein, Non-structural protein 7 Protein (MALS verified) [His]. E. coli 100 µg $940.00
VReP-Wyb161 Recombinant SARS-COV-2 NSP8 Protein (aa 1-198) [His] SARS-COV-2, Recombinant Protein, Non-structural protein 8 Protein [His]. E. coli 100 µg $940.00
VReP-Wyb162 Recombinant SARS-COV-2 NP Protein (aa 1-419) [His] (Biotinylated) SARS-COV-2, Recombinant Protein, Nucleocapsid Protein (335Gly/Ala) [His] (Biotinylated). Baculovirus-Insect Cells 20 µg $1499.00
VReP-Wyb163 Recombinant SARS-COV-2 S RBD Protein (aa 319-541) SARS-COV-2, Recombinant Protein, Spike RBD Protein. HEK293 Cells 100 µg $976.00
VReP-Wyb164 Recombinant SARS-COV-2 S RBD Protein (aa 319-541) [His] (Biotinylated) SARS-COV-2, Recombinant Protein, Spike RBD Protein [His] (Biotinylated). HEK293 Cells 20 µg $1499.00
VReP-Wyb165 Recombinant SARS-COV-2 S2-mFc Protein (aa 686-1213) [His] SARS-COV-2, Recombinant Protein, Spike S2 ECD fused with Fc region of mouse IgG1 at the C-terminus Protein [His]. Baculovirus-Insect Cells 100 µg $1929.00
VReP-Wyb166 Recombinant SARS-COV-2 Plpro Protein (aa 1564-1880) [His] SARS-COV-2, Recombinant Protein, papain-like protease Protein [His]. E. coli 100 µg $976.00
VReP-Wyb167 Recombinant SARS-COV-2 S1 Protein (aa 16-685) [His] (Biotinylated) SARS-COV-2, Recombinant Protein, Spike S1 Protein [His] (Biotinylated). HEK293 Cells 20 µg $1499.00
VReP-Wyb168 Recombinant SARS-COV-2 RBD-mFc Protein (aa 319-541) [Fc] SARS-COV-2, Recombinant Protein, Spike RBD fused with Fc region of mouse IgG1 at the C-terminus Protein [Fc]. HEK293 Cells 100 µg $1929.00
VReP-Wyb169 Recombinant SARS-COV-2 RBD-rFc Protein (aa 319-541) [Fc] SARS-COV-2, Recombinant Protein, Spike RBD fused with Fc region of rabbit IgG1 at the C-terminus Protein [Fc]. HEK293 Cells 100 µg $976.00
VReP-Wyb170 Recombinant SARS-COV-2 S RBD Protein (aa 319-541) [His] (Biotinylated) (Baculovirus-Insect Cells) SARS-COV-2, Recombinant Protein, Spike RBD Protein [His] (Biotinylated). Baculovirus-Insect Cells 20 µg $1499.00
VReP-Wyb171 Recombinant SARS-COV-2 S2-Fc Protein (aa 686-1213) [His] SARS-COV-2, Recombinant Protein, Spike S2 ECD fused with Fc region of human IgG1 at the C-terminus Protein [His]. HEK293 Cells 100 µg $1929.00
VReP-Wyb172 Recombinant SARS-COV-2 ME Protein (aa 6799-7096) [His] SARS-COV-2, Recombinant Protein, Methyltransferase Protein [His]. E. coli 100 µg $1929.00
VReP-Wyb195 Recombinant SARS-CoV-2 Spike S1 mutant (aa 16-685, D614G) Protein [His] SARS-CoV-2, Recombinant Protein, Spike S1 (D614G) mutant. HEK293 Cells 100 µg $1953.00
VReP-Wyb196 Recombinant SARS-CoV-2 Spike RBD mutant (aa 319-541, V367F) Protein [His] SARS-CoV-2, Recombinant Protein, Spike RBD (V367F) mutant. HEK293 Cells 100 µg $1953.00
VReP-Wyb197 Recombinant SARS-CoV-2 Spike RBD mutant (aa 319-541, K458R) Protein [His] SARS-CoV-2, Recombinant Protein, Spike RBD (V367F) mutant. HEK293 Cells 100 µg $1953.00
VReP-Wyb198 Recombinant SARS-CoV-2 Spike RBD mutant (aa 319-541, F342L) Protein [His] SARS-CoV-2, Recombinant Protein, Spike RBD (F342L) mutant. HEK293 Cells 100 µg $1953.00
VReP-Wyb199 Recombinant SARS-CoV-2 Spike RBD mutant (aa 319-541, V483A) Protein [His] SARS-CoV-2, Recombinant Protein, Spike RBD (V483A) mutant. HEK293 Cells 100 µg $1953.00
VReP-Wyb200 Recombinant SARS-CoV-2 Spike RBD mutant (aa 319-541, A435S) Protein [His] SARS-CoV-2, Recombinant Protein, Spike RBD (A435S) mutant. HEK293 Cells 100 µg $1953.00
VReP-Wyb201 Recombinant SARS-CoV-2 Spike RBD mutant (aa 319-541, N354D) Protein [His] SARS-CoV-2, Recombinant Protein, Spike RBD (N354D) mutant. HEK293 Cells 100 µg $1953.00
VReP-Wyb202 Recombinant SARS-CoV-2 Spike RBD mutant (aa 319-541, G476S) Protein [His] SARS-CoV-2, Recombinant Protein, Spike RBD (G476S) mutant. HEK293 Cells 100 µg $1953.00
VReP-Wyb203 Recombinant SARS-CoV-2 Nucleocapsid (aa 1-419, 335Gly/Ala) Protein [His] (Biotinylated) SARS-CoV-2, Recombinant Protein, Nucleocapsid was expressed with a C-terminal polyhistidine tagged AVI tag at the C-terminus. The purified protein was biotinylated in vitro. Baculovirus-Insect Cells 20 µg $1518.00
VReP-Wyb204 Recombinant SARS-CoV-2 Spike S1 (16-685) Protein [AVI-His] (Biotinylated) SARS-CoV-2, Recombinant Protein, Spike S1 was expressed with a C-terminal polyhistidine tagged AVI tag at the C-terminus. The purified protein was biotinylated in vitro. HEK293 Cells 20 µg $1518.00
VReP-Wyb205 Recombinant SARS-CoV-2 Spike RBD (aa 319-541) Protein [AVI-His] (Biotinylated) SARS-CoV-2, Recombinant Protein, Spike RBD was expressed with a C-terminal polyhistidine tagged AVI tag at the C-terminus. The purified protein was biotinylated in vitro. HEK293 Cells 20 µg $1518.00
VReP-Wyb206 Recombinant SARS-CoV-2 Spike RBD Protein [mFC] SARS-CoV-2, Recombinant Protein, Spike RBD was expressed with a mFC tag. The purified protein has a predicted molecular weight of 50 KDa. Human Cells 100 µg $1276.00
VReP-Wyb207 Recombinant SARS-CoV-2 3C-like Proteinase Protein (aa 1-306) [His] (Bioactivity) SARS-COV-2, Recombinant Protein, 3C-like Proteinase was expressed with a 6His tag at the N-terminus. E. coli 10 µg $336.00
VReP-Wyb208 Recombinant SARS-CoV-2 Papain-Like Protease Protein (aa 1564-1878) (Bioactivity) SARS-COV-2, Recombinant Protein, Papain-Like Protease was expressed targeting gene encoding Glu1564-Lys1878. E. coli 10 µg $404.00
VReP-Wyb212 Recombinant SARS-CoV-2 NSP10 Protein (aa 1-139) [His] SARS-COV-2, Recombinant Protein, NSP10 was expressed with a 6His tag at the N-terminus. E. coli 10 µg $404.00
VReP-Wyb213 Recombinant SARS-CoV-2 NSP2 Protein (aa 1-638) [His] SARS-COV-2, Recombinant Protein, NSP2 was expressed with a 6His tag at the C-terminus. E. coli 10 µg $336.00
VReP-Wyb214 Recombinant SARS-CoV-2 Guanine-N7 methyltransferase Protein (aa 1-527) [His] SARS-COV-2, Recombinant Protein, Guanine-N7 methyltransferase (nsp14) was expressed with a 6His tag at the N-terminus. E. coli 10 µg $404.00
VReP-Wyb215 Recombinant SARS-CoV-2 Helicase (nsp13) Protein (aa 1-601) [His] SARS-COV-2, Recombinant Protein, Helicase (nsp13) was expressed with a 6His tag at the C-terminus. E. coli 10 µg $336.00
VReP-Wyb216 Recombinant SARS-CoV-2 Spike-trimer Protein (aa 15-1208) [His] SARS-COV-2, Recombinant Protein, Spike-trimer was expressed with a 6His tag at the C-terminus. Mammalian Expression System Inquiry
More +
CAT# Product Name Product Overview Specificity Data sheet SIZE PRICE Add to basket
VAb-Wyb043 SARS-CoV-2 Spike Monoclonal Antibody (Rabbit) SARS-CoV-2 (2019-nCoV), Rabbit Monoclonal Antibody, specific for SARS-CoV-2 spike protein. SARS-CoV-2 spike, cross-reactivity in ELISA with SARS-CoV S1 and RBD. 50 µL $503.00
VAb-Wyb044 SARS-CoV-2 Nucleoprotein Monoclonal Antibody (Rabbit) SARS-CoV-2 (2019-nCoV), Rabbit Monoclonal Antibody, specific for SARS-CoV-2 NP protein. SARS-CoV-2 Nucleocapsid, cross-reactivity in ELISA and WB with SARS-CoV NP. 50 µL $503.00
VAb-Wyb048 SARS-CoV-2 Nucleoprotein Polyclonal Antibody (Rabbit) SARS-CoV-2 (2019-nCoV), Rabbit Polyclonal Antibody, specific for SARS-CoV-2 Nucleocapsid protein. SARS-CoV Nucleocapsid, cross-reactivity in ELISA and WB with SARS-CoV-2 Nucleoprotein. 50 µL $503.00
VAb-Wyb049 SARS-CoV-2 Nucleoprotein Monoclonal Antibody (Mouse) SARS-CoV-2 (2019-nCoV), Mouse Monoclonal Antibody, specific for SARS-CoV-2 Nucleocapsid protein. SARS-CoV Nucleocapsid, cross-reactivity in ELISA and WB with SARS-CoV-2 Nucleoprotein. 50 µL $503.00
VAb-Wyb050 SARS-CoV-2 Spike Monoclonal Antibody (Human-Mouse) SARS-CoV-2 (2019-nCoV), Monoclonal Antibody (chimeric Mab by the human IgG1 with mouse variable regions), specific for SARS-CoV-2 Spike S1 Protein. SARS-CoV Spike, cross-reactivity in ELISA and WB with SARS-CoV-2 Spike S1 Protein. 50 µL $503.00
VAb-Wyb051 SARS-CoV-2 NP Monoclonal Antibody (Rabbit) SARS-CoV-2 (2019-nCoV), Rabbit Monoclonal Antibody; specific for nucleoprotein. SARS-CoV Nucleocapsid, cross-reactivity in ELISA and WB with SARS-CoV-2 Nucleoprotein. 50 µL $503.00
VAb-Wyb052 SARS-CoV-2 NP Monoclonal Antibody (Mouse) SARS-CoV-2 (2019-nCoV), Mouse Monoclonal Antibody; specific for nucleoprotein. SARS-CoV Nucleocapsid, cross-reactivity in ELISA and WB with SARS-CoV-2 Nucleoprotein. 50 µL $503.00
VAb-Wyb053 SARS-CoV-2 S Monoclonal Antibody (Human-Mouse) SARS-CoV-2 (2019-nCoV), Monoclonal Antibody (chimeric Mab by the human IgG1 with mouse variable regions); specific for spike. SARS-CoV spike, cross-reactivity in ELISA with SARS-CoV-2 Spike S1 Protein. 50 µL $503.00
VAb-Wyb054 SARS-CoV-2 S1/S1 RBD Antibody (Human) SARS-CoV-2 (2019-nCoV), Recombinant human IgG1 Antibody (Clone: HC2001); specific for S1 subunit and S1 RBD of spike, 1 mg/ml. SARS-CoV Spike Protein S1 subunit and S1 RBD. 100 µg $881.00
VAb-Wyb060 SARS-CoV-2 ORF7a Monoclonal IgG1 Antibody (Mouse) SARS-CoV-2 (2019-nCoV), Mouse IgG1 Antibody (Clone: 3C9); 1 mg/ml. SARS-CoV; SARS-CoV-2 25 µL $465.00
VAb-Wyb063 SARS-CoV-2 NSP8 Monoclonal IgG1 Antibody (Mouse) SARS-CoV-2 (2019-nCoV), Mouse IgG1 Antibody (Clone: 5A10); 2 mg/ml. SARS-CoV; SARS-CoV-2 25 µL $465.00
VAb-Wyb065 SARS-CoV-2 NP Monoclonal IgG1 Antibody (Clone: 6H3) (Mouse) SARS-CoV-2 (2019-nCoV), Mouse IgG1 Antibody (Clone: 6H3); 2.25 mg/ml. SARS-CoV; SARS-CoV-2 25 µL $465.00
VAb-Wyb066 SARS-CoV-2 S Monoclonal IgG1 Antibody (Mouse) SARS-CoV-2 (2019-nCoV), Mouse IgG1 Antibody (Clone: 1A9); 1 mg/ml. SARS-CoV; SARS-CoV-2 25 µL $465.00
VAb-Wyb076 SARS-CoV-2 NP Monoclonal IgG2b Antibody (Mouse) SARS-CoV-2 (2019-nCoV), Mouse anti-Nucleocapsid IgG2b Antibody, Antigen Affinity purified. SARS-CoV & SARS-CoV-2 Nucleoprotein 100 µg $623.00
VAb-Wyb077 SARS-CoV-2 Polyclonal IgG Antibody (Rabbit) SARS-CoV-2 (2019-nCoV), Rabbit IgG Antibody, Purity˃ 95%. SARS-CoV; SARS-CoV-2 50 µg $999.00
VAb-Wyb078 SARS-CoV-2 Nucleoprotein Monoclonal IgG1 Antibody (Mouse) SARS-CoV-2 (2019-nCoV), Nucleoprotein Mouse IgG1 Antibody, Antigen Affinity purified. SARS-CoV & SARS-CoV-2 & MERS-CoV NP 50 µg $623.00
VAb-Wyb079 SARS-CoV-2 NP Monoclonal IgG Antibody (Mouse) SARS-CoV-2 (2019-nCoV), Nucleoprotein Mouse IgG Antibody (Clone: 6F10), purity>95%. SARS-CoV-2 NP 50 µg $999.00
VAb-Wyb082 SARS-CoV-2/SARS-CoV NP Monoclonal IgG1 Antibody (Mouse) SARS-CoV-2 (2019-nCoV)/SARS-CoV, Nucleoprotein Mouse IgG1 Antibody, Antigen Affinity purified. SARS-CoV-2 & SARS-CoV NP 100 µg $623.00
VAb-Lsx001 SARS-CoV-2 Spike 1 Neutralizing Antibody (Mouse Mab) SARS-CoV-2 (2019-nCoV) Spike Neutralizing Antibody (Monoclonal Mouse IgG1 Clone #43), specific for SARS-CoV-2 Spike S1 Protein. SARS-CoV-2 Spike S1, cross-reactivity in ELISA with SARS-CoV-2 Spike RBD Protein. 100 µg $1465.00
VAb-Lsx002 SARS-CoV-2 Spike RBD Neutralizing Antibody (Mouse Mab) SARS-CoV-2 (2019-nCoV) Spike Neutralizing Antibody (Monoclonal Mouse IgG2b Clone #57), specific for SARS-CoV-2 Spike RBD Protein. SARS-CoV-2 Spike RBD, cross-reactivity in ELISA with SARS-CoV-2 Spike S1 Protein. 100 µg $1465.00
VAb-Wyb091 SARS-CoV-2 Spike S1-RBD Monoclonal IgM Antibody (Human Chimeric) SARS-CoV-2 (2019-nCoV), Spike S1-RBD Human Chimeric
IgM Antibody, specific for S1 subunit and S1 RBD of spike, 1 mg/mL.
SARS-CoV-2 Spike Protein S1 subunit and its RBD domain. 100 µg $1076.00
VAb-Wyb092 SARS-CoV-2 Spike Neutralizing Antibody Antibody (Rabbit MAb) SARS-CoV-2 (2019-nCoV), Spike Neutralizing IgG Antibody, specific for S1 subunit of spike, Rabbit Mab. SARS-CoV-2 Spike Protein and its S1 subunit. 100 µg $1344.00
VAb-Wyb093 SARS-CoV-2 Spike S2 Antibody Antibody (Chimeric MAb) SARS-CoV-2 (2019-nCoV), Spike S2 Antibody, specific for S2 subunit of spike, Monoclonal mouse (variable region) / human (kappa / IgG1 constant) chimeric antibody. Specific for SARS-CoV-2 Spike Protein and its S2 subunit, NO cross-reactivity in ELISA with MERS-CoV Spike Spike S2, SARS-CoV-2 Spike S1, SARS-CoV-2 Spike RBD. 100 µg $1344.00
VAb-Wyb094 SARS-CoV-2 NP ScFv Antibody [His-Flag] SARS-CoV-2 (2019-nCoV), Nucleocapsid Single-chain variable fragment Antibody, specific for Nucleocapsid, produced by our E. coli expression system with a 6His, Flag tag at the C-terminus. Antibody recognizes SARS-CoV-2 Nucleocapsid Protein Inquiry
VAb-Wyb095 SARS-CoV-2 NP ScFv Antibody [Fc] SARS-CoV-2 (2019-nCoV), Nucleocapsid Single-chain variable fragment Antibody, specific for Nucleocapsid, cultured in vitro under conditions free from animal derived components. Antibody recognizes SARS-CoV-2 Nucleocapsid Protein Inquiry
VAb-Wyb096 SARS-CoV-2 Spike Antibody IgG&IgM Positive Control (MAb) The product contains two isotype antibody clone Human IgG and IgM, which can recognizes SARS-CoV-2 Spike-RBD Protein. Antibody recognizes SARS-CoV-2 S-RBD Protein Inquiry
VAb-Wyb097 SARS-CoV-2 NP Antibody IgG&IgM Positive Control (MAb) The product contains two isotype antibody clone Human IgG and IgM, which can recognizes SARS-CoV-2 Nucleocapsid Protein. Antibody recognizes SARS-CoV-2 Nucleocapsid Protein Inquiry
VAb-Wyb098 SARS-CoV-2 Spike Neutralizing Antibody (Human IgG1) The product serotype human IgG1 recognizes SARS-CoV-2 S/S-RBD Protein and block ACE-2 receptor binding. Antibody recognizes SARS-CoV-2 S/S-RBD Protein Inquiry
VAb-Wyb099 SARS-CoV-2 Spike Neutralizing Antibody (Mouse IgG1) The product serotype mouse IgG1 recognizes SARS-CoV-2 S/S-RBD Protein and block ACE-2 receptor binding. Antibody recognizes SARS-CoV-2 S/S-RBD Protein Inquiry
VAb-Wyb100 SARS-CoV-2 Spike Neutralizing Antibody (Cynomolgus IgG1) The product serotype cynomolgus IgG1 recognizes SARS-CoV-2 S/S-RBD Protein and block ACE-2 receptor binding. Antibody recognizes SARS-CoV-2 S/S-RBD Protein Inquiry
VAb-Wyb101 SARS-CoV-2 Spike Neutralizing Antibody (Human IgM) The product serotype human IgM recognizes SARS-CoV-2 S/S-RBD Protein and block ACE-2 receptor binding. Antibody recognizes SARS-CoV-2 S/S-RBD Protein Inquiry
VAb-Wyb102 SARS-CoV-2 Spike Neutralizing Antibody (Human IgA) The product serotype human IgA recognizes SARS-CoV-2 S/S-RBD Protein and block ACE-2 receptor binding. Antibody recognizes SARS-CoV-2 S-RBD Protein Inquiry
CAT# Product Name Product Overview Vector Data sheet SIZE PRICE Add to basket
VPLd-Wyb114 SARS-CoV-2 S-V483A-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike RBD mutant (V483A) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb115 SARS-CoV-2 S-H519Q-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike RBD mutant (H519Q) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb116 SARS-CoV-2 S-A520S-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike RBD mutant (A520S) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb117 SARS-CoV-2 S-G476S-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike RBD mutant (G476S) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb118 SARS-CoV-2 S-A348T-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike RBD mutant (A348T) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb119 SARS-CoV-2 S-R408I-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike RBD mutant (R408I) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb120 SARS-CoV-2 S-V367F-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike RBD mutant (V367F) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb121 SARS-CoV-2 S-T323I-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike RBD mutant (T323I) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb122 SARS-CoV-2 S-A522S-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike RBD mutant (A522S) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb123 SARS-CoV-2 S-K529E-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike RBD mutant (K529E) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb124 SARS-CoV-2 S-D614G-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (D614G) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb125 SARS-CoV-2 S-L5F-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (L5F) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb126 SARS-CoV-2 S-A570V-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (A570V) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb127 SARS-CoV-2 S-T240I-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (T240I) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb128 SARS-CoV-2 S-A27V-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (A27V) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb129 SARS-CoV-2 S-S50L-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (S50L) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb130 SARS-CoV-2 S-D111N-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (D111N) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb131 SARS-CoV-2 S-E96D-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (E96D) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb132 SARS-CoV-2 S-T29I-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (T29I) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb133 SARS-CoV-2 S-L54F, D614G-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (L54F, D614G) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb134 SARS-CoV-2 S-H655Y-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (H655Y) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb135 SARS-CoV-2 S-Y28N-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (Y28N) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb136 SARS-CoV-2 S-H49Y-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (H49Y) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb137 SARS-CoV-2 S-G181V-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (G181V) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb138 SARS-CoV-2 S-F157L-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (F157L) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb139 SARS-CoV-2 S-S221W-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (S221W) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb140 SARS-CoV-2 S-S247R-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (S247R) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb141 SARS-CoV-2 S-L54F-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (L54F) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb142 SARS-CoV-2 S-144deletion-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (144deletion) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb143 SARS-CoV-2 S-R682Q-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (R682Q) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb144 SARS-CoV-2 S-D614G, P631S-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (D614G, P631S) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb145 SARS-CoV-2 S-E298G, D614G-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (E298G, D614G) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb146 SARS-CoV-2 S-V90F, D614G-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (V90F, D614G) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb147 SARS-CoV-2 S-A653V-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (A653V) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb148 SARS-CoV-2 S-L5F, D614G-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (L5F, D614G) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb149 SARS-CoV-2 S-D80Y-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (D80Y) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb150 SARS-CoV-2 S-Q271R, D614G-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (Q271R, D614G) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb151 SARS-CoV-2 S-N74K-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (N74K) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb152 SARS-CoV-2 S-N148S-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (N148S) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb153 SARS-CoV-2 S-H146Y, D614G-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (H146Y, D614G) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb154 SARS-CoV-2 S-S98F-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (S98F) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb155 SARS-CoV-2 S-W258L, D614G-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (W258L, D614G) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb156 SARS-CoV-2 S-I197V-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (I197V) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb157 SARS-CoV-2 S-P9L-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (P9L) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb158 SARS-CoV-2 S-V70F-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (V70F) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb159 SARS-CoV-2 S-D614G, V622I-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (D614G, V622I) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb160 SARS-CoV-2 S-D614G, V615F-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (D614G, V615F) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb161 SARS-CoV-2 S-S71F-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (S71F) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb162 SARS-CoV-2 S-D614G, Q675H-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (D614G, Q675H) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
VPLd-Wyb163 SARS-CoV-2 S-P631S-mut Plasmid (pCDNA3.1(+)) SARS-CoV-2, Spike S1 mutant (P631S) Plasmid, pCDNA3.1(+). pCDNA3.1(+) Inquiry
More +
CAT# Product Name Product Overview Gene Name Data sheet SIZE PRICE Add to basket
Vpcr-Wyb001 SARS-CoV-2-N1-F SARS-CoV-2 -N1 Forward Primer SARS-CoV-2 N1 Inquiry
Vpcr-Wyb002 SARS-CoV-2-N1-R SARS-CoV-2 -N1 Reverse Primer SARS-CoV-2 N1 Inquiry
Vpcr-Wyb003 SARS-CoV-2-N1-P SARS-CoV-2 -N1 Probe SARS-CoV-2 N1 Inquiry
Vpcr-Wyb004 SARS-CoV-2-N2-F SARS-CoV-2 -N1 Forward Probe SARS-CoV-2 N2 Inquiry
Vpcr-Wyb005 SARS-CoV-2-N2-R SARS-CoV-2 -N2 Reverse Probe SARS-CoV-2 N2 Inquiry
Vpcr-Wyb006 SARS-CoV-2-N2-P SARS-CoV-2 -N2 Probe SARS-CoV-2 N2 Inquiry
Vpcr-Wyb007 SARS-CoV-2-N3-F SARS-CoV-2 -N3 Forward Primer SARS-CoV-2 N3 Inquiry
Vpcr-Wyb008 SARS-CoV-2-N3-R SARS-CoV-2 -N3 Reverse Primer SARS-CoV-2 N3 Inquiry
Vpcr-Wyb009 SARS-CoV-2-N3-P SARS-CoV-2 -N3 Probe SARS-CoV-2 N3 Inquiry
Vpcr-Wyb010 SARS-CoV-2-RdRP-F SARS-CoV-2 -RdRP Forward Primer SARS-CoV-2 RdRP Inquiry
Vpcr-Wyb011 SARS-CoV-2-RdRP-R SARS-CoV-2 -RdRP Reverse Primer SARS-CoV-2 RdRP Inquiry
Vpcr-Wyb012 SARS-CoV-2-RdRP-P1 SARS-CoV-2 -RdRP Probe 1 SARS-CoV-2 RdRP Inquiry
Vpcr-Wyb013 SARS-CoV-2-RdRP-P2 SARS-CoV-2 -RdRP Probe 2 SARS-CoV-2 RdRP Inquiry
Vpcr-Wyb018 SARS-CoV-2-E-F SARS-CoV-2 -E Forward Primer SARS-CoV-2 E 5 nmol $103.00
Vpcr-Wyb019 SARS-CoV-2-E-R SARS-CoV-2 -E Reverse Primer SARS-CoV-2 E 5 nmol $103.00
Vpcr-Wyb020 SARS-CoV-2-E-P SARS-CoV-2 -E Probe SARS-CoV-2 E 10 nmol $414.00
Vpcr-Wyb021 SARS-CoV-2-N-F SARS-CoV-2 -N Forward Primer SARS-CoV-2 N 5 nmol $103.00
Vpcr-Wyb022 SARS-CoV-2-N-R SARS-CoV-2 -N Reverse Primer SARS-CoV-2 N 5 nmol $103.00
Vpcr-Wyb023 SARS-CoV-2 Lyophilized Primers and Probe Mix (E gene) SARS-CoV-2 SARS-CoV-2 Lyophilized Primers and Probe Mix (E gene) for RT-PCR SARS-CoV-2 E 10 nmol $414.00
Vpcr-Wyb024 SARS-CoV-2 E gene stabilized RNA (As positive control) SARS-CoV-2 E gene stabilized RNA is lyophilized encapsidated RNA which has been stabilized to serve as positive control for extraction and real time RT-PCR targeting E gene. SARS-CoV-2 E 5 nmol $103.00
Vpcr-Wyb025 SARS-CoV-2-ORF1ab-R SARS-CoV-2 -ORF1ab Reverse Primer SARS-CoV-2 ORF1ab 5 nmol $103.00
Vpcr-Wyb026 SARS-CoV-2-ORF1ab-P SARS-CoV-2 -ORF1ab Probe SARS-CoV-2 ORF1ab 10 nmol $414.00
CAT# Product Name Product Overview Specificity Data sheet SIZE PRICE Add to basket
VCok-Wyb001 SARS-CoV-2 (2019-nCoV) Spike Protein ELISA Kit The ready-to-use detection kit SARS-CoV-2 (2019-nCoV) Spike ELISA Kit is an enzyme-linked immunosorbent assay for the quantitative measurement of SARS-CoV-2 spike protein. Recognizes both natural and recombinant SARS-CoV-2 spike/S protein. 1 Kit (96Tests) $1676.00
VCok-Wyb002 SARS-CoV-2 (2019-nCoV) Nucleoprotein Protein ELISA Kit The ready-to-use detection kit SARS-CoV-2 (2019-nCoV) Nucleoprotein ELISA Kit is an enzyme-linked immunosorbent assay for the quantitative measurement of SARS-CoV-2 nucleocapsid. Recognizes both natural and recombinant SARS-CoV-2 nucleocapsid. 1 Kit (96Tests) $1676.00
VCok-Wyb003 SARS-CoV-2 (2019-nCoV) IgG/IgM Rapid Test Kit The SARS-CoV-2 (2019-nCoV) IgG/IgM Rapid Test Kit is an immunochromatographic-based assay for the simultaneous detection of IgG and IgM antibodies to SARS-CoV-2 virus in human serum, plasma or whole blood. The assay can be used as an aid in the diagnosis of COVID-19. IgG and IgM antibodies to SARS-CoV-2 virus 1 Kit (20Tests) $235.00
VCok-Wyb004 SARS-CoV-2 (2019-nCoV) Total Antibody Rapid Test Kit The SARS-CoV-2 (2019-nCoV) IgG/IgM Rapid Test Kit is a chromatographic lateral flow test-based assay for the detection of total antibodies (IgG and IgM) to SARS-CoV-2 virus in human serum, plasma or whole blood. The assay can be used as an aid in the diagnosis of COVID-19. IgG and IgM antibodies to SARS-CoV-2 virus Inquiry
VCok-Wyb005 SARS-CoV-2 (2019-nCoV) Anti-NP IgG ELISA Kit The SARS-CoV-2 (2019-nCoV) Anti-NP IgG ELISA Kit is a highly sensitive and specific enzyme-linked immunosorbent assay (ELISA) for the qualitative detection of IgG class antibodies against the nucleocapsid protein (NP) of SARS-CoV-2 virus in human serum, plasma or whole blood. IgG antibodies to NP of SARS-CoV-2 virus 1 Kit $494.00
VCok-Wyb006 SARS-CoV-2 (2019-nCoV) Anti-S1 RBD IgG ELISA Kit The SARS-CoV-2 (2019-nCoV) Anti-S1 RBD IgG ELISA Kit is a highly sensitive and specific enzyme-linked immunosorbent assay (ELISA) for the qualitative detection of IgG class antibodies against the S1 RBD of spike protein of SARS-CoV-2 virus in human serum, plasma or whole blood. IgG antibodies to S1 RBD of SARS-CoV-2 virus 1 Kit $494.00
VCok-Wyb007 SARS-CoV-2 (2019-nCoV) ORF1ab qRT-PCR (Taqman™) Detection Kit The SARS-CoV-2 (2019-nCoV) ORF1ab qRT-PCR (Taqman™) Detection Kit is designed based on the gene sequences of ORF1ab gene of SARS-CoV-2 genome and is used for the quantitative detection of ORF1ab gene. The kit is for research use only, not for diagnoses. ORF1ab gene of SARS-CoV-2 virus genome. 1 Kit (100Tests) $609.00
VCok-Wyb008 SARS-CoV-2 (2019-nCoV) N qRT-PCR (Taqman™) Detection Kit The SARS-CoV-2 (2019-nCoV) N qRT-PCR (Taqman™) Detection Kit is designed based on the gene sequences of N gene of SARS-CoV-2 genome and is used for the quantitative detection of N gene. The kit is for research use only, not for diagnoses. N gene of SARS-CoV-2 virus genome. 1 Kit (100Tests) $609.00
VCok-Wyb009 SARS-CoV-2 (2019-nCoV) RdRP qRT-PCR (Taqman™) Detection Kit The SARS-CoV-2 (2019-nCoV) RdRP qRT-PCR (Taqman™) Detection Kit is designed based on the gene sequences of RdRP gene of SARS-CoV-2 genome and is used for the quantitative detection of RdRP gene. The kit is for research use only, not for diagnoses. RdRP gene of SARS-CoV-2 virus genome. 1 Kit (100Tests) $609.00
VCok-Wyb010 SARS-CoV-2 (2019-nCoV) E qRT-PCR (Taqman™) Detection Kit The SARS-CoV-2 (2019-nCoV) E qRT-PCR (Taqman™) Detection Kit is designed based on the gene sequences of E gene of SARS-CoV-2 genome and is used for the quantitative detection of E gene. The kit is for research use only, not for diagnoses. E gene of SARS-CoV-2 virus genome. 1 Kit (100Tests) $609.00
VCok-Wyb011 SARS-CoV-2 (2019-nCoV) S1-RBD IgG/IgM ELISA Detection Kit The SARS-CoV-2 (2019-nCoV) S1-RBD IgG/IgM ELISA Detection Kit is designed based on the indirect ELISA and is used for the evaluation of IgG or IgM against SARS-CoV-2 Spike S1-RBD in samples. The kit is for research use only, not for diagnoses. IgG or IgM antibodies to S1 RBD of SARS-CoV-2 virus 1 Kit (96Tests) $1293.00
VCok-Wyb012 SARS-CoV-2 (2019-nCoV) S1-RBD IgG ELISA Detection Kit The SARS-CoV-2 (2019-nCoV) S1-RBD IgG ELISA Detection Kit is designed based on the indirect ELISA and is used for the evaluation of IgG against SARS-CoV-2 Spike S1-RBD in samples. The kit is for research use only, not for diagnoses. IgG antibodies to S1 RBD of SARS-CoV-2 virus 1 Kit (96Tests) $1293.00
VCok-Wyb013 SARS-CoV-2 (2019-nCoV) RT-qPCR Detection Kit The SARS-CoV-2 (2019-nCoV) RT-qPCR Detection Kit is designed based on Real-time RT-PCR and is used for the detection of the presence of SARS-CoV-2 in respiratory specimens and serum samples. The kit is for research use only, not for diagnoses. SARS-CoV-2 Virus 1 Kit (100Tests) $588.00
VCok-Wyb014 SARS-CoV-2 (2019-nCoV) RT-qPCR Detection Kit (96-well Ready) The SARS-CoV-2 (2019-nCoV) RT-qPCR Detection Kit (96-well Ready) is designed based on Real-time RT-PCR and is used for the detection of the presence of SARS-CoV-2 in respiratory specimens and serum samples. The kit is for research use only, not for diagnoses. SARS-CoV-2 Virus 1 Kit (24Tests) $588.00
VCok-Wyb015 SARS-CoV-2 (2019-nCoV) CDC Probe and Primer Kit The SARS-CoV-2 (2019-nCoV) CDC Probe and Primer Kit is designed based on Real-time RT-PCR and is used for the detection of the presence of SARS-CoV-2. The kit is for research use only, not for diagnoses. SARS-CoV-2 Virus 1 Kit (1000 rxns) $541.00
VCok-Wyb016 SARS-CoV-2 (2019-nCoV) IgG Antibody Detection Kit The SARS-CoV-2 (2019-nCoV) IgG Antibody Detection Kit is an immunochromatography-based assay for the detection of IgG antibodies to SARS-CoV-2 virus in human serum, plasma or whole blood. The assay can be used as an aid in the diagnosis of COVID-19. IgG antibodies to SARS-CoV-2 virus 1 Kit (20Tests) $705.00
VCok-Wyb017 SARS-CoV-2 (2019-nCoV) IgM Antibody Detection Kit The SARS-CoV-2 (2019-nCoV) IgM Antibody Detection Kit is an immunochromatography-based assay for the detection of IgM antibodies to SARS-CoV-2 virus in human serum, plasma or whole blood. The assay can be used as an aid in the diagnosis of COVID-19. IgM antibodies to SARS-CoV-2 virus 1 Kit (20Tests) $705.00
VCok-Wyb019 Human ANPEP ELISA Detection Kit The Human ANPEP ELISA Detection Kit is a sandwich ELISA-based assay for the quantitative detection of human alanyl (membrane) aminopeptidase in serum, plasma, tissue homogenates. Human ANPEP Inquiry
VCok-Wyb020 Human CD147 ELISA Detection Kit The Human CD147 ELISA Detection Kit is a sandwich ELISA-based assay for the quantitative detection of human cluster of differentiation 147 in serum, plasma. Human CD147 Inquiry
VCok-Wyb021 Human CTSB ELISA Detection Kit The Human CTSB ELISA Detection Kit is a sandwich ELISA-based assay for the quantitative detection of human cathepsin B in serum, plasma, tissue homogenates. Human CTSB Inquiry
VCok-Wyb022 SARS-CoV-2 (2019-nCoV) qPCR Detection Kit The SARS-CoV-2 (2019-nCoV) qPCR Detection Kit is based on RT-PCR for the in vitro detection of SARS-CoV-2 in respiratory specimens. SARS-CoV-2 Virus 1 Kit (100 Rxns) $1163.00
VCok-Wyb025 SARS-CoV-2 (2019-nCoV) Multiplex qRT-PCR Detection Kit The SARS-CoV-2 (2019-nCoV) Multiplex qRT-PCR Detection Kit is designed based on real time RT-PCR for the direct qualitative detection of 2019-nCoV RNA in respiratory specimens. The kit is for research use only, not for diagnoses. SARS-CoV-2 virus genome. Inquiry
VCok-Wyb026 SARS-CoV-2 (2019-nCoV) One-Step RT-PCR Mix SARS-CoV-2 (2019-nCoV) One-Step RT-PCR Mix includes the latest advances in buffer chemistry and PCR enhancers and stabilizers, with an antibody-mediated hot-start polymerase, dNTPs and MgCl2 and separate reverse transcriptase and Rnase inhibitor. Inquiry
VCok-Wyb027 SARS-CoV-2 (2019-nCoV) Lyo-ready RT-PCR Mix SARS-CoV-2 (2019-nCoV) Lyo-ready RT-PCR Mix includes Taq polymerase, reaction buffer, dNTP, MgCl2 and lyo-excipients and separate reverse transcriptase and dilution buffer. Inquiry
VCok-Wyb028 SARS-CoV-2 (2019-nCoV) Lyo-ready RT-PCR Virus Mix SARS-CoV-2 (2019-nCoV) Lyo-ready RT-PCR Virus Mix includes Taq polymerase, RNase inhibitor, reaction buffer, dNTP, MgCl2 and lyo-excipients and separate reverse transcriptase and dilution buffer. Inquiry
VCok-Wyb029 SARS-CoV-2 IgG ELISA Kit The SARS-CoV-2 IgG ELISA kit is used for the qualitative detection of novel coronavirus IgG antibodies in human serum or plasma in vitro. This product is for research use only and is not intended for diagnostic use. SARS-CoV-2 1 Kit (96Tests) $750.00
VCok-Wyb030 SARS-CoV-2 IgM ELISA Kit The SARS-CoV-2 IgM ELISA kit is used for the qualitative detection of novel coronavirus IgM antibodies in human serum or plasma in vitro. This product is for research use only and is not intended for diagnostic use. SARS-CoV-2 1 Kit (96Tests) $750.00
VCok-Wyb031 SARS-CoV-2 S Gene Visual RT-LAMP Kit This kit is based on the loop-mediated isothermal amplification (LAMP) technology and is specifically used to detect the S gene of a new coronavirus (SARS-CoV-2). This product is for research use only and is not intended for diagnostic use. SARS-CoV-2 1 Kit (50Tests) $1105.00
VCok-Wyb032 SARS-CoV-2 N Gene Visual RT-LAMP Kit This kit is based on the loop-mediated isothermal amplification (LAMP) technology and is specifically used to detect the N gene of a new coronavirus (SARS-CoV-2). This product is for research use only and is not intended for diagnostic use. SARS-CoV-2 1 Kit (50Tests) $1105.00
VCok-Wyb033 SARS-CoV-2 (2019-nCoV) Spike RBD Antibody Titer ELISA Kit The ready-to-use detection kit SARS-CoV-2 (2019-nCoV) Spike RBD Antibody Titer ELISA Kit is an enzyme-linked immunosorbent assay for the qualitative measurement of anti-SARS-CoV-2 (2019-nCoV) Spike RBD antibodies in serum. SARS-CoV-2 1 Kit (96Tests) $1676.00
VCok-Wyb034 SARS-CoV-2 (2019-nCoV) Spike S1 Antibody Titer ELISA Kit The ready-to-use detection kit SARS-CoV-2 (2019-nCoV) Spike S1 Antibody Titer ELISA Kit is an enzyme-linked immunosorbent assay for the qualitative measurement of anti-SARS-CoV-2 (2019-nCoV) Spike S1 antibodies in serum. SARS-CoV-2 1 Kit (96Tests) $1676.00
VCok-Wyb035 SARS-CoV-2 (2019-nCoV) Spike S1+S2 ECD Antibody Titer ELISA Kit The ready-to-use detection kit SARS-CoV-2 (2019-nCoV) Spike S1+S2 ECD Antibody Titer ELISA Kit is an enzyme-linked immunosorbent assay for the qualitative measurement of anti-SARS-CoV-2 (2019-nCoV) Spike S1+S2 ECD antibodies in serum. SARS-CoV-2 1 Kit (96Tests) $1676.00
VCok-Wyb036 SARS-CoV-2 (2019-nCoV) Nucleocapsid Antibody Titer ELISA Kit The ready-to-use detection kit SARS-CoV-2 (2019-nCoV) Nucleocapsid Antibody Titer ELISA Kit is an enzyme-linked immunosorbent assay for the qualitative measurement of anti-SARS-CoV-2 (2019-nCoV) Nucleocapsid antibodies in serum. SARS-CoV-2 1 Kit (96Tests) $1676.00
CAT# Product Name Product Overview Quantity Data sheet SIZE PRICE Add to basket
VCeL-Wyb001 A549 (Frozen Instant Format) A549, Human Lung Carcinoma cell line, Assay Ready Format. 5×106 cells/vial 50 vials $8552.00
VCeL-Wyb002 A549 (Growing) A549, Human Lung Carcinoma cell line, Growing Format. 2xT25 cell culture flasks 2xT25 cell culture flasks $1003.00
VCeL-Wyb003 A549 (Frozen Cryovial) A549, Human Lung Carcinoma cell line, Frozen Cryovial Format. 2×106 cells/vial 1.5 mL $792.00
VCeL-Wyb004 BHK-21 (Frozen Cryovial) BHK-22, Hamster Kidney Fibroblastoid cell line, Frozen Cryovial Format. 1.5×106 cells/vial 1.5 mL $792.00
VCeL-Wyb005 BHK-21 (Growing) BHK-22, Hamster Kidney Fibroblastoid cell line, Growing Format. 2xT25 cell culture flasks 2xT25 cell culture flasks $1003.00
VCeL-Wyb006 CaCo-2 (Frozen Cryovial) CaCo-2, Human Colon Adenocarcinoma cell line, Frozen Cryovial Format. 2×106 cells/vial 1.5 mL $895.00
VCeL-Wyb007 CaCo-2 (Growing) CaCo-2, Human Colon Adenocarcinoma cell line, Growing Format. 2xT25 cell culture flasks 2xT25 cell culture flasks $1159.00
VCeL-Wyb008 HEK293 (Frozen Cryovial) HEK293, Human embryonic kidney cell line, Frozen Cryovial Format. 4×106 cells/vial 1.5 mL $792.00
VCeL-Wyb009 HEK293 (Growing) HEK293, Human embryonic kidney cell line, Growing Format. 2xT25 cell culture flasks 2xT25 cell culture flasks $1003.00
VCeL-Wyb010 HuH7 (Frozen Cryovial) HuH7, Human Liver carcinoma cell line, Frozen Cryovial Format. 1.5×106 cells/vial 1.5 mL $1351.00
VCeL-Wyb011 HuH7 (Growing) HuH7, Human Liver carcinoma cell line, Growing Format. 2xT25 cell culture flasks 2xT25 cell culture flasks $1544.00
VCeL-Wyb012 MDCK (Frozen Cryovial) MDCK, Madin-Darby-Canine-Kidney cell line, Frozen Cryovial Format. 2×106 cells/vial 1.5 mL $799.00
VCeL-Wyb013 MDCK (Growing) MDCK, Madin-Darby-Canine-Kidney cell line, Growing Format. 2xT25 cell culture flasks 2xT25 cell culture flasks $1003.00
VCeL-Wyb014 PK-15 (Frozen Cryovial) PK-15, Pig Kidney cell line, Frozen Cryovial Format. 2×106 cells/vial 1.5 mL $799.00
VCeL-Wyb015 PK-15 (Growing) PK-15, Pig Kidney cell line, Growing Format. 2xT25 cell culture flasks 2xT25 cell culture flasks $1003.00
VCeL-Wyb016 VERO (Frozen Cryovial) VERO, Monkey Kidney cell line, Frozen Cryovial Format. 2×106 cells/vial 1.5 mL $799.00
VCeL-Wyb017 VERO (Growing) VERO, Monkey Kidney cell line, Growing Format. 2xT25 cell culture flasks 2xT25 cell culture flasks $1003.00
VCeL-Wyb018 VERO (Serum Free Culture) VERO, Monkey Kidney cell line, Adapted to serum free culture conditions, Frozen Cryovial Format. 2×106 cells/vial 1.5 mL $1208.00
VCeL-Wyb019 ACE2-CHO Cell-line ACE2-CHO is established by integrating human ACE2 into the chromosomes of CHO cells to form a clonal cell line, that stably expresses ACE2 on the cell surface. Stable ACE2-CHO Cell-line provides an effective tool for further studying the interaction between the receptor ACE2 and COVID-19. 4×106 cells/ml 1 mL $4500.00
VCeL-Wyb020 ACE2-293T Cell Line Human ACE2 gene was integrated into the chromosomes of 293T cells to form a clonal cell line, ACE2-293T, that stably expresses ACE2 on the cell surface. 3-5×106 cells/ml 1 mL $4500.00
CAT# Product Name Product Overview Sequence Data sheet SIZE PRICE Add to basket
VPpt-Wyb001 SARS-CoV-2 Mpro Substrate Prototype Fluorescence Substrate/ inhibitor for SARS-CoV-2 or SARS-CoV Main Protease (Mpro): Ac-Abu-Tle-Leu-Gln-AMC (Ac-Abu(2)-Tle-Leu-Gln-AMC). Ac-Abu-Tle-Leu-Gln-AMC (Ac-Abu(2)-Tle-Leu-Gln-AMC) Inquiry
VPpt-Wyb002 Substrate for SARS-CoV-2 Mpro Prototype Fluorescence Substrate/inhibitor for SARS-CoV-2 or SARS-CoV Main Protease (Mpro): Ac-Thz-Tle-Leu-Gln-AMC. Ac-Thz-Tle-Leu-Gln-AMC Inquiry
VPpt-Wyb003 Human Angiotensin (1-7) Biologically active peptides, Human Angiotensin (1-7): Asp-Arg-Val-Tyr-Ile-His-Pro • AcOH • 4H2O. Asp-Arg-Val-Tyr-Ile-His-Pro • AcOH • 4H2O 25 mg $919.00
VPpt-Wyb004 Human Angiotensin II Biologically active peptides, Human Angiotensin II: Asp-Arg-Val-Tyr-Ile-His-Pro-Phe • AcOH • 4H2O. Asp-Arg-Val-Tyr-Ile-His-Pro-Phe • AcOH • 4H2O 25 mg $1199.00
VPpt-Wyb005 Human C-Peptide Biologically active peptides, Insulin Precursor (57-87), Human C-Peptide: H-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro- Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-OH. H-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro- Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-OH 1 mg $491.00
VPpt-Wyb006 Fibronectin Adhesion-Promoting Peptide Biologically active peptides, Fibronectin Adhesion-Promoting Peptide: H-Trp-Gln-Pro-Pro-Arg-Ala-Arg-Ile-OH. H-Trp-Gln-Pro-Pro-Arg-Ala-Arg-Ile-OH 1 mg $115.00
VPpt-Wyb007 Rat/Mouse GO-CoA-Tat Biologically active peptides, Rat/Mouse GO-CoA-Tat: H-Gly-Ser-α-Dap-β-(2-CoA-Octanoyl)-Phe-Leu-Ser-Pro-Glu-His-Gln-Ahx-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-OH. H-Gly-Ser-α-Dap-β-(2-CoA-Octanoyl)-Phe-Leu-Ser-Pro-Glu-His-Gln-Ahx-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-OH 500 µg $2075.00
VPpt-Wyb008 OVA Peptide Biologically active peptides, OVA Peptide: H-Ser-Ile-Ile-Asn-Phe-Glu-Lys-Leu-OH. H-Ser-Ile-Ile-Asn-Phe-Glu-Lys-Leu-OH 1 mg $127.00
VPpt-Wyb009 SARS-CoV-2 (2019-nCoV) ORF10 Peptide Pool MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT 1 vial (25 µg/peptide) $353.00
VPpt-Wyb012 SARS-CoV-2 (2019-nCoV) ORF7b Peptide Pool MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA 1 vial (25 µg/peptide) $353.00
VPpt-Wyb023 SARS-CoV-2 (2019-nCoV) Spike Receptor Binding Motif SNNLDSKVGGNYNYLYRLFRK 100 µg $176.00
VPpt-Wyb024 SARS-CoV-2 (2019-nCoV) Spike 96-well Overlapping Peptide Pool 5 µmol $19691.00
VPpt-Wyb025 ACE-2 Fluorescent Substrate Mca-Ala-Pro-Lys(Dnp)-OH 1 mg $310.00
VPpt-Wyb026 ACE2 Inhibitor Ac-GDYSHCSPLRYYPWWKCTYPDPEGGG-NH2 100 µg $284.00
VPpt-Wyb027 3CLpro (nsp5 or Mpro) FRET peptide substrate ESATLQSGLRKAK 100 µg $416.00
VPpt-Wyb028 Human Pro Neuropeptide Y peptide (aa 34-43) RQRYGKRSSPK 100 µg $468.00
VPpt-Wyb029 SARS-CoV-2 (2019-nCoV) Spike RBD Peptide (aa 319-335) RVQPTESIVRFPNITNL 500 µg $548.00
VPpt-Wyb030 SARS-CoV-2 (2019-nCoV) Spike RBD Peptide (aa 319-335) (Biotin - LC) RVQPTESIVRFPNITNL-K(Biotin-LC) 100 µg $209.00
VPpt-Wyb031 SARS-CoV-2 (2019-nCoV) Spike RBD Peptide (aa 336-347) CPFGEVFNATRF 500 µg $423.00
VPpt-Wyb032 SARS-CoV-2 (2019-nCoV) Spike RBD Peptide (aa 336-347) (Biotin - LC) CPFGEVFNATRF-K(Biotin-LC) 100 µg $202.00
VPpt-Wyb033 SARS-CoV-2 (2019-nCoV) Spike RBD Peptide (aa 348-357) ASVYAWNRKR 500 µg $423.00
VPpt-Wyb034 SARS-CoV-2 (2019-nCoV) Spike RBD Peptide (aa 348-357) (Biotin - LC) ASVYAWNRKR - K(Biotin - LC) 100 µg $174.00
VPpt-Wyb035 SARS-CoV-2 (2019-nCoV) Spike RBD Peptide (aa 352-365) AWNRKRISNCVADY 500 µg $472.00
VPpt-Wyb036 SARS-CoV-2 (2019-nCoV) Spike RBD Peptide (aa 352-365) (Biotin - LC) AWNRKRISNCVADY - K(Biotin - LC) 100 µg $207.00
VPpt-Wyb037 SARS-CoV-2 (2019-nCoV) Spike RBD Peptide (aa 371-394) SASFSTFKCYGVSPTKLNDLCFTN 500 µg $818.00
VPpt-Wyb038 SARS-CoV-2 (2019-nCoV) Spike RBD Peptide (aa 371-394) (Biotin - LC) SASFSTFKCYGVSPTKLNDLCFTN - K(Biotin - LC) 100 µg $301.00
VPpt-Wyb039 SARS-CoV-2 (2019-nCoV) Spike RBD Peptide (aa 395-430) VYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT 500 µg $928.00
VPpt-Wyb040 SARS-CoV-2 (2019-nCoV) Spike RBD Peptide (aa 395-430) (Biotin - LC) VYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT - K(Biotin - LC) 100 µg $510.00
VPpt-Wyb041 SARS-CoV-2 (2019-nCoV) Spike RBD Peptide (aa 513-520) LSFELLHA 500 µg $468.00
VPpt-Wyb042 SARS-CoV-2 (2019-nCoV) Spike RBD Peptide (aa 513-520) (Biotin - LC) LSFELLHA - K(Biotin - LC) 100 µg $329.00
VPpt-Wyb043 SARS-CoV-2 (2019-nCoV) Spike RBD Peptide (aa 523-541) TVCGPKKSTNLVKNKCVNF 500 µg $693.00
VPpt-Wyb044 SARS-CoV-2 (2019-nCoV) Spike RBD Peptide (aa 523-541) (Biotin - LC) TVCGPKKSTNLVKNKCVNF - K(Biotin - LC) 100 µg $270.00
VPpt-Wyb045 SARS-CoV-2 (2019-nCoV) Spike RBD Peptide (aa 450-473) NYLYRLFRKSNLKPFERDISTEIY 500 µg $818.00
VPpt-Wyb046 SARS-CoV-2 (2019-nCoV) Spike RBD Peptide (aa 450-473) (Biotin - LC) NYLYRLFRKSNLKPFERDISTEIY - K(Biotin - LC) 100 µg $273.00
VPpt-Wyb047 SARS-CoV-2 (2019-nCoV) Spike RBD Peptide (aa 480-496) CNGVEGFNCYFPLQSYG 500 µg $632.00
VPpt-Wyb048 SARS-CoV-2 (2019-nCoV) Spike RBD Peptide (aa 480-496) (Biotin - LC) CNGVEGFNCYFPLQSYG - K(Biotin - LC) 100 µg $230.00
VPpt-Wyb049 SARS-CoV-2 (2019-nCoV) Spike RBD Peptide (aa 500-509) TNGVGYQPYR 500 µg $371.00
VPpt-Wyb050 SARS-CoV-2 (2019-nCoV) Spike RBD Peptide (aa 500-509) (Biotin - LC) TNGVGYQPYR - K(Biotin - LC) 100 µg $174.00
VPpt-Wyb051 SARS-CoV-2 (2019-nCoV) Spike protein (S1/S2) substrate TNSPRRARSVAS - K 100 µg $468.00
VPpt-Wyb052 SARS-CoV-2 (2019-nCoV) Spike protein S2 substrate SKPSKRSFIED 100 µg $468.00
CAT# Product Name Product Overview Sensitivity Data sheet SIZE PRICE Add to basket
VCye-Wyb001 Human IFN-γ ELISA Kit Human IFN-γ ELISA Kit is used for quantitative determination of human interferon γ (IFN-γ) concentrations in serum, cell culture supernates, urine, tissue homogenates and cerebrospinal fluid (CSF). 1.56 pg/mL 1 kit (96Tests) $1062.00
VCye-Wyb002 Human IL-10 ELISA Kit Human IL-10 ELISA Kit is used for quantitative determination of human interleukin 10 (IL-10) concentrations in serum, urine, cell culture supernates, ascitic fluid, cerebrospinal fluid (CSF), saliva. 3.12 pg/mL 1 kit (96Tests) $1196.00
VCye-Wyb003 Human IL12A ELISA KIT Human IL12A ELISA KIT is used for quantitative determination of human interleukin-12 subunit alpha (IL12A) concentrations in serum, plasma, cell culture supernates. 3.9 pg/mL 1 kit (96Tests) $1196.00
VCye-Wyb004 Human IL-15 ELISA KIT Human IL-15 ELISA KIT is used for quantitative determination of human interleukin 15 (IL-15) concentrations in serum, plasma, tissue homogenates, cell culture
0.78 pg/mL 1 kit (96Tests) $1196.00
VCye-Wyb005 Human IL-17 ELISA KIT Human IL-17 ELISA KIT is used for quantitative determination of human interleukin 17A (IL-17A/IL-17) concentrations in serum, urine, cell culture supernates, tissue homogenates. 1.56 pg/mL 1 kit (96Tests) $1062.00
VCye-Wyb006 Human IL-1β ELISA KIT Human IL-1β ELISA KIT is used for quantitative determination of human interleukin 1β (IL-1β) concentrations in serum, cell culture supernates, urine, cerebrospinal fluid (CSF). 31.25 pg/mL 1 kit (96Tests) $1062.00
VCye-Wyb007 Human IL-2 ELISA KIT Human IL-2 ELISA KIT is used for quantitative determination of human interleukin 2 (IL-2) concentrations in serum, plasma, tissue homogenates. 0.78 pg/mL 1 kit (96Tests) $1196.00
VCye-Wyb008 Human IL-6 ELISA KIT Human IL-6 ELISA KIT is used for quantitative determination of human interleukin 6 concentrations in serum, plasma, cell culture supernates, urine, tissue homogenates. 2.453 pg/mL 1 kit (96Tests) $1196.00
VCye-Wyb009 Human IL-7 ELISA KIT Human IL-7 ELISA KIT is used for quantitative determination of human interleukin-7 (IL-7) concentrations in serum, plasma, cell culture supernates, tissue homogenates. 0.195 pg/mL 1 kit (96Tests) $1196.00
VCye-Wyb010 Human IP-10 ELISA KIT Human IP-10 ELISA KIT is used for quantitative determination of human interferon-inducible protein 10 (IP-10) concentrations in serum, plasma, tissue homogenates. 7.8 pg/mL 1 kit (96Tests) $1062.00
VCye-Wyb011 Human MCP-1/MCAF ELISA KIT Human MCP-1/MCAF ELISA KIT is used for quantitative determination of human monocyte chemotactic protein 1/monocyte chemotactic and activating factor (MCP-1/MCAF) concentrations in serum, plasma, urine, saliva, cerebrospinal fluid (CSF), ascitic fluid, cell culture supernates, tissue homogenates. 30.184 pg/mL 1 kit (96Tests) $1062.00
VCye-Wyb012 Human MIP-1α ELISA KIT Human MIP-1α ELISA KIT is used for quantitative determination of human macrophage inflammatory protein-1α (MIP-1α) concentrations in serum, plasma, tissue homogenates. 0.78 pg/mL 1 kit (96Tests) $1062.00
VCye-Wyb013 Human TNF-α ELISA KIT Human TNF-α ELISA KIT is used for quantitative determination of human tumor necrosis factor α (TNF-α) concentrations in serum, plasma, cell culture supernates, tissue homogenates, cell lysates. 1.95 pg/mL 1 kit (96Tests) $1062.00
CAT# Product Name Product Overview CAS No. Data sheet SIZE PRICE Add to basket
Vinh-Wyb001 Lopinavir Molecular Formula: C37H48N4O5; Molecular Weight: 628.8 g.mol-1 192725-17-0 10 mg $1161.00
Vinh-Wyb002 [2H6]-Lopinavir Molecular Formula: C37H48N4O5 or C37H42D6N4O5; Molecular Weight: 634.84 g.mol-1 12117674-22-0 1 mg $1650.00
Vinh-Wyb003 [2H8]-Lopinavir Molecular Formula: C37H40D8N4O5; Molecular Weight: 636.85 g.mol-1 1322625-54-6 1 mg $1090.00
Vinh-Wyb004 Lopinavir metabolite M-1 Molecular Formula: C37H46N4O6; Molecular Weight: 642.78 g.mol-1 192725-39-6 1 mg $1650.00
Vinh-Wyb005 Lopinavir metabolite M-3/M-4 Molecular Formula: C37H48N4O6; Molecular Weight: 644.8 g.mol-1 221553-72-6 1 mg $1650.00
Vinh-Wyb006 Ritonavir Molecular Formula: C37H48N6O5S2; Molecular Weight: 720.96 g.mol-1 155213-67-5 10 mg $1161.00
Vinh-Wyb007 [2H6]-Ritonavir Molecular Formula: C37H42D6N6O5S2; Molecular Weight: 726.98 g.mol-1 1217720-20-1 0.5 mg $905.00
Vinh-Wyb008 [13C3]-Ritonavir Molecular Formula: C37H42D6N6O5S2; Molecular Weight: 726.98 g.mol-1 1217673-23-8 0.5 mg $975.00
Vinh-Wyb009 [13C,2H3]-Ritonavir Molecular Formula: C37H48N6O5S2 or C3613CH45D3N6O5S2; Molecular Weight: 724.96 g.mol-1 Unlabelled 155213-67-5 1 mg $1650.00
Vinh-Wyb010 Ritonavir A-86093 internal standard Molecular Formula: C39H50N6O5S2; Molecular Weight: 746.98 g.mol-1 202816-70-4 1 mg $1650.00
Vinh-Wyb011 [2H6]-Desthiazolylmethyloxycarbonyl Ritonavir Molecular Formula: C32H45N5O3S; Molecular Weight: 579.80 g.mol-1 1217772-02-5 1 mg $719.00
Vinh-Wyb012 Remdesivir Molecular Formula: C27H35N6O8P; Molecular Weight: 602.58 g.mol-1 1809249-37-3 1 mg $1424.00
Vinh-Wyb013 Chloroquine Molecular Formula: C18H26ClN3; Molecular Weight: 319.87 g.mol-1 58175-87-4 1 mg $1650.00
Vinh-Wyb014 Chloroquine Phosphate Molecular Formula: C18H26ClN3.2H3O4P; Molecular Weight: 515.86 g.mol-1 50-63-5 10 mg $1161.00
Vinh-Wyb015 Chloroquine sulfate Molecular Formula: C18H26ClN3.H2SO4; Molecular Weight: 417.95 g.mol-1 132-73-0 1 mg $1650.00
Vinh-Wyb016 [2H4]-Chloroquine Phosphate Salt 1 mg $719.00
Vinh-Wyb017 [2H5]-Chloroquine diphosphate salt Molecular Formula: C18H26ClN3.2H3PO4 or C18H21D5ClN3.2H3PO4; Molecular Weight: 520.89 g.mol-1 Unlabelled 50-63-5 1 mg $1650.00
Vinh-Wyb018 [2H5]-Hydroxychloroquine sulfate Molecular Formula: C18H26ClN3O.H2SO4 or C18H21D5ClN3O.H2SO4; Molecular Weight: 438.98 g.mol-1 Unlabelled 747-36-4 1 mg $1650.00
Vinh-Wyb019 [2H5]-Chloroquine oxalate salt Molecular Formula: C18H26ClN3.C2O4H2 or C18H21D5ClN3.C2O4H2; Molecular Weight: 414.94 g.mol-1 1 mg $1650.00
Vinh-Wyb020 [2H10]-Chloroquine diphosphate salt Molecular Formula: C18H26ClN3.2H3PO4 or C18H16D10ClN3.2H3PO4; Molecular Weight: 525.92 g.mol-1 1261396-19-3 1 mg $1650.00
Vinh-Wyb021 [13C6]-Chloroquine diphosphate salt Molecular Formula: C18H26ClN3.2H3PO4 or C1213C6H26ClN3.2H3PO4; Molecular Weight: 521.82 g.mol-1 Unlabelled 50-63-5 1 mg $1650.00
Vinh-Wyb022 Chloroquine analog Molecular Formula: C19H28ClN3; Molecular Weight: 333.9 g.mol-1 85-10-9 1 mg $1650.00
Vinh-Wyb023 Hydroxychloroquine (sulfate) Molecular Formula: C18H26ClN3O.H2O4S; Molecular Weight: 433.95 g.mol-1 747-36-4 25 mg $127.00
Vinh-Wyb024 [2H4]-Hydroxychloroquine (sulfate) Molecular Formula: C18H22D4ClN3O?H2SO4; Molecular Weight: 438.0 g.mol-1 1854126-45-6 500 µg $893.00
Vinh-Wyb025 [2H4]-Hydroxychloroquine Sulfate Molecular Formula: C18H28ClN3O5S; Molecular Weight: 433.95 g.mol-1 1216432-56-2 1 mg $1020.00
Vinh-Wyb026 [2H5]-Hydroxychloroquine dioxalate salt Molecular Formula: C18H26ClN3O.2C2H2O4 or C18H21D5ClN3O.2C2H2O4; Molecular Weight: 520.97 g.mol-1 Unlabelled 118-42-3(free base) 1 mg $1650.00
Vinh-Wyb027 [13C6]-Hydroxychloroquine sulfate Molecular Formula: C18H26ClN3O.H2SO4 or C1213C6H26ClN3O.H2SO4; Molecular Weight: 439.91 g.mol-1 1 mg $1650.00
Vinh-Wyb028 Desethylchloroquine Molecular Formula: C16H22ClN3; Molecular Weight: 291.82 g.mol-1 1476-52-4 1 mg $1650.00
Vinh-Wyb029 [2H4]-Desethyl Chloroquine Molecular Formula: C16H22ClN3; Molecular Weight: 291.82 g.mol-1 1189971-72-9 1 mg $905.00
Vinh-Wyb030 [2H5]-Desethylchloroquine Molecular Formula: C16H22ClN3 or C16H17D5ClN3; Molecular Weight: 296.85 g.mol-1 1261392-69-1 1 mg $1650.00
Vinh-Wyb031 Desethylchloroquine diphosphate salt Molecular Formula: C16H22ClN3.2H3PO4; Molecular Weight: 487.81 g.mol-1 247912-76-1 1 mg $1650.00
Vinh-Wyb032 [2H5]-Desethylchloroquine diphosphate salt Molecular Formula: C16H22ClN3.2H3PO4 or C16H17D5ClN3.2H3PO4; Molecular Weight: 492.84 g.mol-1 1261397-17-4 1 mg $1650.00
Vinh-Wyb033 [2H5]-Desethylchloroquine dioxalate salt Molecular Formula: C16H22ClN3.2C2H2O4 or C16H17D5ClN3.2C2H2O4; Molecular Weight: 476.92 g.mol-1 1 mg $1650.00
Vinh-Wyb034 [13C6]-Desethylchloroquine diphosphate salt Molecular Formula: C16H22ClN3.2H3PO4 or C1013C6H22ClN3.2H3PO4; Molecular Weight: 493.77 g.mol-1 Unlabelled 247912-76-1 1 mg $1650.00
Vinh-Wyb035 Desethylhydroxychloroquine Dihydrochloride Molecular Formula: C16H22ClN3O.2ClH; Molecular Weight: 380.74 g.mol-1 4298-15-1 1 mg $1617.00
Vinh-Wyb036 [2H4]-Didesethyl Chloroquine Molecular Formula: C14H18ClN3; Molecular Weight: 263.77 g.mol-1 1215797-41-3 1 mg $905.00
Vinh-Wyb037 Favipiravir Molecular Formula: C5H4FN3O2; Molecular Weight: 157.10 g.mol-1 259793-96-9 5 mg $531.00
Vinh-Wyb038 Azithromycin Molecular Formula: C38H72N2O12; Molecular Weight: 748.98 g.mol-1 83905-01-5 25 mg $230.00
Vinh-Wyb039 Azithromycin dihydrate Molecular Formula: C38H72N2O12 . 2H2O; Molecular Weight: 785.02 g.mol-1 117772-70-0 25 mg $928.00
Vinh-Wyb040 [2H3]-Azithromycin Molecular Formula: C38H69D3N2O12; Molecular Weight: 752.0 g.mol-1 163921-65-1 1 mg $1149.00
Vinh-Wyb041 SARS-CoV-2 (2019-nCoV) Inhibitor Screening Kit The SARS-CoV-2 (2019-nCoV) Inhibitor Screening Kit is designed to facilitate the identification and characterization of SARS-CoV-2 inhibitors. The kit contains a SARS-CoV-2 S protein RBD protein, a biotinylated Human ACE2 protein, an SARS-CoV-2 inhibitor (as method verified Reference), and Streptavidin-HRP reagent. 96tests $1410.00
Vinh-Wyb042 Chloroquine phosphate (>99% Pure) Molecular Formula: C18H32ClN3O8P2; Molecular Weight: 515.86 g.mol-1 50-63-5 100 mg $155.00
Vinh-Wyb043 Remdesivir (GS-5734) Molecular Formula: C27H35N6O8P; Molecular Weight: 602.58 g.mol-1 1809249-37-3 1 mg $517.00
Vinh-Wyb044 Hydroxychloroquine sulfate (HCQ sulfate) Molecular Formula: C18H28ClN3O5S; Molecular Weight: 433.95 g.mol-1 747-36-4 50 mg $141.00
Vinh-Wyb045 Favipiravir (T-705) Molecular Formula: C5H4FN3O2; Molecular Weight: 157.10 g.mol-1 259793-96-9 5 mg $118.00
Vinh-Wyb046 Lopinavir (ABT-378) Molecular Formula: C37H48N4O5; Molecular Weight: 628.80 g.mol-1 192725-17-0 50 mg $141.00
Vinh-Wyb047 SARS-CoV-IN-3 Molecular Formula: C25H20ClFeN3O; Molecular Weight: 469.74 g.mol-1 888958-27-8 Inquiry
Vinh-Wyb048 SARS-CoV-IN-1 Molecular Formula: C23H16ClFeN3O; Molecular Weight: 441.69 g.mol-1 888958-25-6 Inquiry
Vinh-Wyb049 6-Thioguanine (Thioguanine, 2-Amino-6-purinethiol) Molecular Formula: C5H5N5S; Molecular Weight: 167.19 g.mol-1 154-42-7 100 mg $141.00
Vinh-Wyb050 Mizoribine (NSC 289637, HE 69) Molecular Formula: C9H13N3O6; Molecular Weight: 259.22 g.mol-1 50924-49-7 10 mg $118.00
More +
CAT# Product Name Product Overview Chemical Modification Data sheet SIZE PRICE Add to basket
VAp-Lsx001 SARS-CoV-2 Spike S1 Aptamer A1-56nt This product is an aptamer which binds to the SARS-CoV-2 Spike S1 protein with an affinity of 7.78 nM. None 5 OD $282.00
VAp-Lsx002 SARS-CoV-2 Spike S1 Aptamer A1-56nt (thiol) This product is an thiol-modified aptamer which binds to the SARS-CoV-2 Spike S1 protein with an affinity of 7.78 nM. 5'-thiol-modified ssDNA 5 OD $931.00
VAp-Lsx003 SARS-CoV-2 Spike S1 Aptamer A1-56nt (amino) This product is an amino-modified aptamer which binds to the SARS-CoV-2 Spike S1 protein with an affinity of 7.78 nM. 5'-amino-modified ssDNA 5 OD $705.00
VAp-Lsx004 SARS-CoV-2 Spike S1 Aptamer A1-56nt (biotin) This product is an biotin-modified aptamer which binds to the SARS-CoV-2 Spike S1 protein with an affinity of 7.78 nM. 5'-biotin-modified ssDNA 5 OD $705.00
VAp-Lsx005 SARS-CoV-2 Spike S1 Aptamer A2-56nt This product is an aptamer which binds to the SARS-CoV-2 Spike S1 protein with an affinity of 2.97 nM. None 5 OD $282.00
VAp-Lsx006 SARS-CoV-2 Spike S1 Aptamer A2-56nt (thiol) This product is an thiol-modified aptamer which binds to the SARS-CoV-2 Spike S1 protein with an affinity of 2.97 nM. 5'-thiol-modified ssDNA 5 OD $931.00
VAp-Lsx007 SARS-CoV-2 Spike S1 Aptamer A2-56nt (amino) This product is an amino-modified aptamer which binds to the SARS-CoV-2 Spike S1 protein with an affinity of 2.97 nM. 5'-amino-modified ssDNA 5 OD $705.00
VAp-Lsx008 SARS-CoV-2 Spike S1 Aptamer A2-56nt (biotin) This product is an biotin-modified aptamer which binds to the SARS-CoV-2 Spike S1 protein with an affinity of 2.97 nM. 5'-biotin-modified ssDNA 5 OD $705.00
VAp-Lsx009 SARS-CoV-2 Spike S1 Aptamer A1-24nt This product is an aptamer which binds to the SARS-CoV-2 Spike S1 protein with an affinity of 4.55 nM. None 5 OD $371.00
VAp-Lsx010 SARS-CoV-2 Spike S1 Aptamer A1-24nt (thiol) This product is an thiol-modified aptamer which binds to the SARS-CoV-2 Spike S1 protein with an affinity of 4.55 nM. 5'-thiol-modified ssDNA 5 OD $1678.00
VAp-Lsx011 SARS-CoV-2 Spike S1 Aptamer A1-24nt (amino) This product is an amino-modified aptamer which binds to the SARS-CoV-2 Spike S1 protein with an affinity of 4.55 nM. 5'-amino-modified ssDNA 5 OD $1269.00
VAp-Lsx012 SARS-CoV-2 Spike S1 Aptamer A1-24nt (biotin) This product is an biotin-modified aptamer which binds to the SARS-CoV-2 Spike S1 protein with an affinity of 4.55 nM. 5'-biotin-modified ssDNA 5 OD $1269.00
VAp-Lsx013 SARS-CoV-2 Spike S1 Aptamer A2-27nt This product is an aptamer which binds to the SARS-CoV-2 Spike S1 protein with an affinity of 9.53 nM. None 5 OD $371.00
VAp-Lsx014 SARS-CoV-2 Spike S1 Aptamer A2-27nt (thiol) This product is an thiol-modified aptamer which binds to the SARS-CoV-2 Spike S1 protein with an affinity of 9.53 nM. 5'-thiol-modified ssDNA 5 OD $1678.00
VAp-Lsx015 SARS-CoV-2 Spike S1 Aptamer A2-27nt (amino) This product is an amino-modified aptamer which binds to the SARS-CoV-2 Spike S1 protein with an affinity of 9.53 nM. 5'-amino-modified ssDNA 5 OD $1269.00
VAp-Lsx016 SARS-CoV-2 Spike S1 Aptamer A2-27nt (biotin) This product is an biotin-modified aptamer which binds to the SARS-CoV-2 Spike S1 protein with an affinity of 9.53 nM. 5'-biotin-modified ssDNA 5 OD $1269.00
VAp-Lsx017 SARS-CoV-2 N Aptamer N1-58nt This product is an aptamer which binds to the SARS-CoV-2 N protein with an affinity of 3.28 nM. None 5 OD $150.00
VAp-Lsx018 SARS-CoV-2 N Aptamer N1-58nt (thiol) This product is an thiol-modified aptamer which binds to the SARS-CoV-2 N protein with an affinity of 3.28 nM. 5'-thiol-modified ssDNA 5 OD $437.00
VAp-Lsx019 SARS-CoV-2 N Aptamer N1-58nt (amino) This product is an amino-modified aptamer which binds to the SARS-CoV-2 N protein with an affinity of 3.28 nM. 5'-amino-modified ssDNA 5 OD $324.00
VAp-Lsx020 SARS-CoV-2 N Aptamer N1-58nt (biotin) This product is an biotin-modified aptamer which binds to the SARS-CoV-2 N protein with an affinity of 3.28 nM. 5'-biotin-modified ssDNA 5 OD $324.00
VAp-Lsx021 SARS-CoV-2 N Aptamer N2-58nt This product is an aptamer which binds to the SARS-CoV-2 N protein with an affinity of 1.91 nM. None 5 OD $150.00
VAp-Lsx022 SARS-CoV-2 N Aptamer N2-58nt (thiol) This product is an thiol-modified aptamer which binds to the SARS-CoV-2 N protein with an affinity of 1.91 nM. 5'-thiol-modified ssDNA 5 OD $437.00
VAp-Lsx023 SARS-CoV-2 N Aptamer N2-58nt (amino) This product is an amino-modified aptamer which binds to the SARS-CoV-2 N protein with an affinity of 1.91 nM. 5'-amino-modified ssDNA 5 OD $324.00
VAp-Lsx024 SARS-CoV-2 N Aptamer N2-58nt (biotin) This product is an biotin-modified aptamer which binds to the SARS-CoV-2 N protein with an affinity of 1.91 nM. 5'-biotin-modified ssDNA 5 OD $324.00
VAp-Lsx025 SARS-CoV-2 N Aptamer N3-58nt This product is an aptamer which binds to the SARS-CoV-2 N protein with an affinity of 7.71 nM. None 5 OD $150.00
VAp-Lsx026 SARS-CoV-2 N Aptamer N3-58nt (thiol) This product is an thiol-modified aptamer which binds to the SARS-CoV-2 N protein with an affinity of 7.71 nM. 5'-thiol-modified ssDNA 5 OD $437.00
VAp-Lsx027 SARS-CoV-2 N Aptamer N3-58nt (amino) This product is an amino-modified aptamer which binds to the SARS-CoV-2 N protein with an affinity of 7.71 nM. 5'-amino-modified ssDNA 5 OD $324.00
VAp-Lsx028 SARS-CoV-2 N Aptamer N3-58nt (biotin) This product is an biotin-modified aptamer which binds to the SARS-CoV-2 N protein with an affinity of 7.71 nM. 5'-biotin-modified ssDNA 5 OD $324.00
VAp-Lsx029 SARS-CoV-2 N Aptamer N4-58nt This product is an aptamer which binds to the SARS-CoV-2 N protein with an affinity of 5.86 nM. None 5 OD $150.00
VAp-Lsx030 SARS-CoV-2 N Aptamer N4-58nt (thiol) This product is an thiol-modified aptamer which binds to the SARS-CoV-2 N protein with an affinity of 5.86 nM. 5'-thiol-modified ssDNA 5 OD $437.00
VAp-Lsx031 SARS-CoV-2 N Aptamer N4-58nt (amino) This product is an amino-modified aptamer which binds to the SARS-CoV-2 N protein with an affinity of 5.86 nM. 5'-amino-modified ssDNA 5 OD $324.00
VAp-Lsx032 SARS-CoV-2 N Aptamer N4-58nt (biotin) This product is an biotin-modified aptamer which binds to the SARS-CoV-2 N protein with an affinity of 5.86 nM. 5'-biotin-modified ssDNA 5 OD $324.00
CAT# Product Name Product Overview Source Data sheet SIZE PRICE Add to basket
VCoS-Wyb001 Recombinant MASP2 Protein (aa 445-686) [His] Human origin Mannan-Binding Lectin serine Peptidase 2 (aa 445-686), MASP2 plays an important role in the activation of the complement system via mannose-binding lectin. Insect Cells Inquiry
VCoS-Wyb002 Recombinant MASP2 Protein (aa 20-443) [His] Mouse origin Mannan-Binding Lectin serine Peptidase 2 (aa 20-443), MASP2 plays an important role in the activation of the complement system via mannose-binding lectin. Insect Cells Inquiry
VCoS-Wyb003 Recombinant MASP2 Protein (aa 444-685) [His] Mouse origin Mannan-Binding Lectin serine Peptidase 2 (aa 444-685), MASP2 plays an important role in the activation of the complement system via mannose-binding lectin. Insect Cells Inquiry
VCoS-Wyb004 Recombinant MASP2 Protein (aa 16-444) [His] Human origin Mannan-Binding Lectin serine Peptidase 2 (aa 16-444), MASP2 plays an important role in the activation of the complement system via mannose-binding lectin. Insect Cells Inquiry
VCoS-Wyb005 Recombinant MASP2 Protein (aa 16-686) [His] Human origin Mannan-Binding Lectin serine Peptidase 2 (aa 16-686), MASP2 plays an important role in the activation of the complement system via mannose-binding lectin. Insect Cells Inquiry
VCoS-Wyb006 Recombinant MASP2 Protein (aa 20-685) [His] Mouse origin Mannan-Binding Lectin serine Peptidase 2 (aa 20-685), MASP2 plays an important role in the activation of the complement system via mannose-binding lectin. Insect Cells Inquiry
VCoS-Wyb007 Recombinant MASP2 Protein (aa 20-685) [His] Mouse origin (E. coli) Mannan-Binding Lectin serine Peptidase 2 (aa 20-685), MASP2 plays an important role in the activation of the complement system via mannose-binding lectin. E. coli 1 mg $21068.00
VCoS-Wyb008 Recombinant MASP2 Protein (aa 20-685) [His] Mouse origin (Yeast) Mannan-Binding Lectin serine Peptidase 2 (aa 20-685), MASP2 plays an important role in the activation of the complement system via mannose-binding lectin. Yeast 1 mg $27934.00
VCoS-Wyb009 Recombinant MASP2 Protein (aa 170-287) [His] Human origin (E. coli) Mannan-Binding Lectin serine Peptidase 2 (aa 170-287), MASP2 plays an important role in the activation of the complement system via mannose-binding lectin. E. coli 100 µg $2061.00
VCoS-Wyb010 Recombinant MASP2 Protein (aa 445-683) [His] (Active) Human origin (E. coli) Mannan-Binding Lectin serine Peptidase 2 (aa 445-683), MASP2 plays an important role in the activation of the complement system via mannose-binding lectin. E. coli 100 µg $3922.00
VCoS-Wyb011 Recombinant MASP2 Protein (aa 20-685) [His] Rat origin (Yeast) Mannan-Binding Lectin serine Peptidase 2 (aa 20-685), MASP2 plays an important role in the activation of the complement system via mannose-binding lectin. Yeast 1 mg $5285.00
VCoS-Wyb012 Recombinant MASP2 Protein (aa 1-686) [GST] Human origin (Wheat germ) Mannan-Binding Lectin serine Peptidase 2 (aa 1-686), MASP2 plays an important role in the activation of the complement system via mannose-binding lectin. Wheat germ Inquiry
VCoS-Wyb013 Anti-C5 Rabbit Polyclonal Antibody (aa 253-281) Complement Component 5 (C5) (aa 253-281) antibody, Polyclonal. Rabbit 400 µL $1471.00
VCoS-Wyb014 Anti-C5a Mouse Monoclonal Antibody (aa 678-751) Complement Component 5a (C5a) (aa 678-751) antibody, Monoclonal. Mouse 100 µL $752.00
VCoS-Wyb015 Anti-C5a Rabbit Polyclonal Antibody (aa 678-751) Complement Component 5a (C5a) (aa 678-751) antibody, Polyclonal, 200 μg/mL. Rabbit 100 µL $602.00
VCoS-Wyb016 Anti-C5 Rabbit Polyclonal Antibody (C-Term) Complement Component 5 (C5) (C-Term) antibody, Polyclonal, 1 mg/mL. Rabbit 100 µL $3692.00
VCoS-Wyb017 Anti-C5 Rabbit Polyclonal Antibody (aa 253-281, C-Term) Complement Component 5 (C5) (N-Term) antibody, Polyclonal, 0.45 mg/mL. Rabbit 400 µL $2601.00
VCoS-Wyb018 Anti-C5 Rabbit Polyclonal Antibody Complement Component 5 (C5) antibody, Polyclonal, IgG. Rabbit 400 µL $2052.00
VCoS-Wyb019 Anti-C5 Mouse Monoclonal Antibody Complement Component 5 (C5) antibody, Monoclonal. Mouse 100 µg $4418.00
VCoS-Wyb020 Anti-C5 Mouse Monoclonal Antibody (Clone:568) Complement Component 5 (C5) antibody, Monoclonal, (Clone:568). Mouse 100 µg $4418.00
VCoS-Wyb021 Anti-C5 Mouse Monoclonal Antibody (Clone:561) Complement Component 5 (C5) antibody, Monoclonal, (Clone:561). Mouse 100 µg $4418.00
VCoS-Wyb022 Anti-C5 Rabbit Polyclonal IgG Antibody Complement Component 5 (C5) IgG antibody, Polyclonal,> 1 mg/mL. Rabbit 100 µL $1471.00
VCoS-Wyb023 Anti-C5 Rabbit Polyclonal IgG Antibody (1 mg/mL) Complement Component 5 (C5) IgG antibody, Polyclonal, 1 mg/mL. Rabbit 100 µL $902.00
VCoS-Wyb024 Anti-C5 Rabbit Polyclonal IgG Antibody (Target Gene ID: 727) Complement Component 5 (C5) antibody, Polyclonal. Rabbit 200 µL $10131.00
VCoS-Wyb025 Anti-C5 Rabbit Polyclonal IgG Antibody (Full length epitope) Complement Component 5 (C5) IgG antibody, Polyclonal. Rabbit 100 µL $1335.00
VCoS-Wyb026 Anti-C5a Mouse Monoclonal IgG1 Antibody (Epitope desArg) Complement Component 5a (C5a) IgG1 antibody, Monoclonal. Mouse 200 µL $8979.00
VCoS-Wyb027 Anti-C5 Mouse Monoclonal IgG1 Antibody Complement Component 5 (C5) IgG1 antibody, Monoclonal. Mouse 50 µg $5647.00
VCoS-Wyb028 Anti-C5 Goat Polyclonal IgG Antibody (FITC-congugated) Complement Component 5 (C5) IgG antibody, Polyclonal. Goat 1 mL $3784.00
VCoS-Wyb029 Anti-C5 Goat Polyclonal Antibody (> 4.5 mg/mL) Complement Component 5 (C5) antibody, Polyclonal,> 4.5 mg/mL. Goat 500 µg $2392.00
VCoS-Wyb030 Anti-C5 Sheep Polyclonal Antibody (> 4.5 mg/mL) Complement Component 5 (C5) antibody, Polyclonal,> 4.5 mg/mL. Sheep 500 µg $4693.00
VCoS-Wyb031 Anti-C5a Rabbit Polyclonal Antibody Complement Component 5a (C5a) antibody, Polyclonal. Rabbit 100 µg $7193.00
VCoS-Wyb032 Anti-C5a Rabbit Polyclonal IgG Antibody Complement Component 5a (C5a) IgG antibody, Polyclonal. Rabbit 100 µg $4136.00
VCoS-Wyb033 Anti-C5 Rabbit Polyclonal IgG Antibody (Un-conjugated) Complement Component 5 (C5) IgG antibody, Polyclonal. Rabbit 100 µL $4947.00
VCoS-Wyb034 Anti-C5 Goat Polyclonal IgG Antibody Complement Component 5 (C5) IgG antibody, Polyclonal. Goat 1 mL $2451.00
VCoS-Wyb035 Anti-C5 Sheep Polyclonal Antibody Complement Component 5 (C5) antibody, Polyclonal. Sheep 15 mL $58238.00
VCoS-Wyb036 Anti-C5 Mouse Polyclonal IgG1 Antibody Complement Component 5 (C5) IgG1 antibody, Polyclonal, 1 mg/mL. Mouse 100 µg $1617.00
VCoS-Wyb037 Anti-C5 Sheep Polyclonal Antibody (> 95% pure) Complement Component 5 (C5) antibody, Polyclonal. Sheep 500 µg $6643.00
VCoS-Wyb038 Anti-C5a Rabbit Polyclonal IgG Antibody (0.5 mg/mL) Complement Component 5a (C5a) IgG antibody, Polyclonal, 0.5 mg/mL. Rabbit 100 µg $1551.00
VCoS-Wyb039 Anti-C5 (N-Term) Rabbit Polyclonal IgG Antibody Complement Component 5 (C5) IgG antibody, Polyclonal, 0.25 mg/mL. Rabbit 400 µL $1889.00
VCoS-Wyb040 Anti-C5a Mouse Monoclonal IgG1 Antibody (Epitope desArg, aa 65-73) Complement Component 5a (C5a) IgG1 antibody, Monoclonal. Mouse 100 µg $3377.00
VCoS-Wyb041 Anti-C5a Mouse Monoclonal IgG1 Antibody Complement Component 5a (C5a) IgG1 antibody, Monoclonal. Mouse 100 µg $3784.00
VCoS-Wyb042 Anti-C5a Mouse Monoclonal IgG1 Antibody (Clone C17-5) Complement Component 5a (C5a) IgG1 antibody, Monoclonal. Mouse 50 µg $1636.00
VCoS-Wyb043 Anti-C5a Mouse Monoclonal IgG1 Antibody (Biotin-conjugated) Complement Component 5a (C5a) IgG1 antibody, Monoclonal. Mouse 100 µg $1737.00
VCoS-Wyb044 Anti-C5a Mouse Monoclonal IgG1 Antibody (FITC-cojugated) Complement Component 5a (C5a) IgG1 antibody, Monoclonal. Mouse 100 µg $1788.00
VCoS-Wyb045 Anti-C5a Mouse Monoclonal IgG1 Antibody (un-conjugated) Complement Component 5a (C5a) IgG1 antibody, Monoclonal. Mouse 200 µg $2040.00
VCoS-Wyb046 Anti-C5a Mouse Monoclonal IgG2a Antibody Complement Component 5a (C5a) IgG2a antibody, Monoclonal. Mouse 100 µg $3377.00
VCoS-Wyb047 Anti-C5a Mouse Monoclonal IgG2a Antibody (Clone 6A533) Complement Component 5a (C5a) IgG2a antibody, Monoclonal. Mouse 100 µg $3377.00
VCoS-Wyb048 Anti-C5a Mouse Monoclonal IgG2a Antibody (Clone 6A534) Complement Component 5a (C5a) IgG2a antibody, Monoclonal. Mouse 100 µg $3377.00
VCoS-Wyb049 Anti-C5a Mouse Monoclonal IgG1 Antibody (Clone 6H13) Complement Component 5a (C5a) IgG1 antibody, Monoclonal. Mouse 100 µg $1986.00
VCoS-Wyb050 Anti-C5a Rabbit Polyclonal Antibody (500 μg/mL) Complement Component 5a (C5a) antibody, Polyclonal, 500 μg/mL. Rabbit 100 µg $1290.00
More +
CAT# Product Name Product Overview Applications Data sheet SIZE PRICE Add to basket
PSV-Wyb001 SARS-CoV-2 Spike-pseudovirus SARS-CoV-2 Spike-pseudovirus was prepared by co-transfecting 293T cells with an HIV-1 backbone plasmid and a plasmid containing the SARS-CoV-2 spike encoding gene. The packaged Spike-pseudovirus expresses full-length spike protein on the surface and carries a luciferase reporter gene, which can be used to infect cells that overexpress ACE2, and express luciferase in the cells to characterize infectivity of the virus. Neutralizing antibody / serum test / As a standard for ELISA and other tests. 200 µL $5990.00
PSV-Wyb002 SARS-CoV-2 Pseudovirus (ORF1 a/b, E, N) SARS-CoV-2 Pseudovirus uses a retroviral vector loaded with the partial sequence of the ORF1 a/b gene of SARS-CoV-2 virus, and the entire sequence of the coding region of the E gene and N gene. This product is prepared in 293T cells and is wrapped around the outer membrane of the retrovirus. This product is used for the ability verification of SARS-CoV-2 virus nucleic acid detection reagents and the performance verification of extraction kits. It can also be used to carry out SARS-CoV-2 virus nucleic acid detection laboratories for test ability verification and laboratory quality control. Used for the ability verification of SARS-CoV-2 virus nucleic acid detection reagents and the performance verification of extraction kits. It can also be used to carry out SARS-CoV-2 virus nucleic acid detection laboratories for test ability verification and laboratory quality control. 1 mL $522.00
PSV-Wyb005 SARS-CoV-2 E Pseudovirus The E gene sequence of the SARS-CoV-2 (2019-nCoV, reference sequence NC_045512) was synthesized and cloned into a lentiviral vector, and the pseudovirus was prepared in 293T cells. The obtained pseudovirus has an RNA sequence containing the E gene 228 base in the lentiviral genome. It can be used as a reference for viral RNA extraction experiments and qPCR detection experiments. Used as a reference for viral RNA extraction experiments and qPCR detection experiments. Inquiry
PSV-Wyb006 SARS-CoV-2 M Pseudovirus The M gene sequence of the SARS-CoV-2 (2019-nCoV, reference sequence NC_045512) was synthesized and cloned into a lentiviral vector, and the pseudovirus was prepared in 293T cells. The obtained pseudovirus has an RNA sequence containing the M gene 669 base in the lentiviral genome. It can be used as a reference for viral RNA extraction experiments and qPCR detection experiments. Used as a reference for viral RNA extraction experiments and qPCR detection experiments. Inquiry
PSV-Wyb007 SARS-CoV-2 N Pseudovirus The N gene sequence of the SARS-CoV-2 (2019-nCoV, reference sequence NC_045512) was synthesized and cloned into a lentiviral vector, and the pseudovirus was prepared in 293T cells. The obtained pseudovirus has an RNA sequence containing the N gene 1260 base in the lentiviral genome. It can be used as a reference for viral RNA extraction experiments and qPCR detection experiments. Used as a reference for viral RNA extraction experiments and qPCR detection experiments. Inquiry
PSV-Wyb008 SARS-CoV-2 S Pseudovirus The S gene sequence of the SARS-CoV-2 (2019-nCoV, reference sequence NC_045512) was synthesized and cloned into a lentiviral vector, and the pseudovirus was prepared in 293T cells. The obtained pseudovirus has an RNA sequence containing the S gene 3822 base in the lentiviral genome. It can be used as a reference for viral RNA extraction experiments and qPCR detection experiments. Used as a reference for viral RNA extraction experiments and qPCR detection experiments. Inquiry
PSV-Wyb009 SARS-CoV-2 1abN Pseudovirus The partial sequence of the 1ab gene and the partial sequence of the N gene of the SARS-CoV-2 (2019-nCoV, reference sequence NC_045512) were synthesized and cloned into a lentiviral vector, and the pseudovirus was prepared in 293T cells. The obtained pseudovirus has an RNA sequence containing the 1abN gene 739 base in the lentiviral genome. It can be used as a reference for viral RNA extraction experiments and qPCR detection experiments. Used as a reference for viral RNA extraction experiments and qPCR detection experiments. Inquiry
CAT# Product Name Product Overview Source Data sheet SIZE PRICE Add to basket
Vpre-Wyb001 Troponin I Cardiac (Human) TnI is the inhibitory subunit of troponin and confers calcium sensitivity to striated muscle actomyosin ATPase activity. Human heart tissue. 100 µg $1753.00
Vpre-Wyb002 Recombinant human cardiac Troponin I Protein (cTnI) Recombinant full-length human cardiac TnI expressed in E. coli contains additional methionine residue at the N-terminus. E. coli 100 µg $1238.00
Vpre-Wyb003 Dephosphorylated Troponin I Cardiac Cardiac isoform of TnI (cTnI) derived from human heart tissue was dephosphorylated in vitro. Human heart tissue. 100 µg $2496.00
Vpre-Wyb004 Phosphorylated Troponin I Cardiac Cardiac isoform of TnI (cTnI) derived from human heart tissue was phosphorylated in vitro. Human heart tissue. 100 µg $2496.00
Vpre-Wyb005 Troponin I-Troponin C complex Troponin I-Troponin C complex are purified from human heart tissue and are tested negative for HBsAg, HIV-1/2 antibodies, syphilis and HCV. Human heart tissue. 50 µg $1784.00
Vpre-Wyb006 Human Troponin Complex (human cardiac troponin I-C-T) Human Troponin Complex contains human cardiac troponin I, human cardiac troponin C, human cardiac troponin T and was purified in mild conditions. Human heart tissue. 100 µg $2136.00
Vpre-Wyb007 Combined Troponin Complex (human cardiac troponin I-C-T) Combined Troponin Complex was prepared by mixing human cTnT, human cTnI and human cTnC in a molar ratio 1:1:1. Human heart tissue. 50 µg $1802.00
Vpre-Wyb008 Human Troponin I (Skeletal Muscle) Human Troponin I are purified from human skeletal muscle and are tested negative for HBsAg, HIV-1/2 antibodies, syphilis and HCV. Human skeletal muscle 100 µg $1990.00
Vpre-Wyb009 Troponin T Cardiac (Human) Human Troponin T are purified from human heart tissue and are tested negative for HBsAg, HIV-1/2 antibodies, syphilis and HCV. Human heart tissue. 100 µg $1050.00
Vpre-Wyb010 Recombinant human cardiac Troponin T Protein (cTnT) Recombinant full-length human cardiac TnT expressed in E. coli contains additional methionine residue at the N-terminus. E. coli 100 µg $524.00
Vpre-Wyb011 Human Troponin T (Skeletal Muscle) Human Troponin T are purified from human skeletal muscle and are tested negative for HBsAg, HIV-1/2 antibodies, syphilis and HCV. Human skeletal muscle 100 µg $1067.00
Vpre-Wyb012 Recombinant skTnT Protein (human fast skeletal troponin T) Recombinant human fast skeletal troponin T was expressed in E. coli contains 261 aa with no tag. E. coli 100 µg $1990.00
Vpre-Wyb013 Recombinant skTnT Protein (human slow skeletal troponin T) Recombinant human slow skeletal troponin T was expressed in E. coli contains 278 aa with no tag. E. coli 100 µg $2388.00
Vpre-Wyb014 Troponin C Cardiac Troponin C was purified from human heart tissue and are tested negative for HBsAg, HIV-1/2 antibodies, syphilis and HCV. Human heart tissue. 100 µg $1990.00
Vpre-Wyb015 Recombinant skTnT/TnC Protein Recombinant human slow skeletal troponin T/cardiac troponin C was expressed in E. coli contains 161 aa with no tag. E. coli 100 µg $2388.00
Vpre-Wyb016 Recombinant troponin C skeletal muscle Protein (Human, isoform 2) Recombinant human troponin C skeletal muscle was expressed in E. coli contains 160 aa with no tag. E. coli 100 µg $2388.00
Vpre-Wyb017 Anti-cTnI Antibody (MAb) Monoclonal Troponin I cardiac antibody, work in Western blotting. 1 mg $679.00
Vpre-Wyb018 Anti-cTnI (Phosphorylated) Antibody (MAb) Monoclonal Troponin I cardiac antibody, specific for phosphorylated form of cTnI. 1 mg $776.00
Vpre-Wyb019 Anti-cTnI (Dephosphorylated) Antibody (MAb) Monoclonal Troponin I cardiac antibody, specific for dephosphorylated form of cTnI. 1 mg $750.00
Vpre-Wyb020 Recombinant anti-cTnI Antibody (MAb) Recombinant monoclonal rabbit anti-cTnI antibody expressed in mammalian cells. Mammalian cells 1 mg $938.00
Vpre-Wyb021 Anti-native cardiac troponin complex Antibody (MAb) Monoclonal Troponin cardiac complex antibody, specific for native cardiac troponin complex. 1 mg $860.00
Vpre-Wyb022 Recombinant anti-native cardiac troponin complex Antibody (chimeric MAb) Recombinant monoclonal anti-native cardiac troponin complex antibody expressed in mammalian cells. Mammalian cells 1 mg $938.00
Vpre-Wyb023 Anti-skTnI Antibody (MAb) Monoclonal Troponin I Skeletal Muscle antibody, specific for Human skTnI. 1 mg $611.00
Vpre-Wyb024 Recombinant anti-cTnT Antibody (chimeric MAb) Recombinant monoclonal chimeric anti-cTnT antibody expressed in mammalian cells. Mammalian cells 1 mg $938.00
Vpre-Wyb025 Anti-TnC Antibody (MAb) Monoclonal Troponin C antibody, specific for Human TnC. Hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice 1 mg $611.00
Vpre-Wyb026 Goat Anti-cTnI Antibody (PAb) Polyclonal Goat Troponin I cardiac antibody, work in Western blotting. 1 mg $374.00
Vpre-Wyb027 Standard Troponin I Free Serum Troponin I free serum is derived from pooled normal human serum and can be used to prepare human cTnI standards and calibrators. Pooled normal human serum 50 mL $888.00
Vpre-Wyb028 Anti-CRP Antibody (MAb) C-reactive protein antibody, derived from hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice. Hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice 1 mg $430.00
Vpre-Wyb029 Human C-Reactive Protein Human C-Reactive Protein was derived from human pleural/ascitic fluid or plasma. Human pleural/ascitic fluid or plasma. 500 µg $261.00
Vpre-Wyb030 Standard CRP Free Serum Human C-Reactive Protein free serum is derived from pooled normal human serum and can be used to prepare human CRP standards and calibrators. Pooled normal human serum 50 mL $888.00
Vpre-Wyb031 Anti-Cystatin C Antibody (MAb) Cystatin C protein antibody, derived from hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice. Hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice 1 mg $776.00
Vpre-Wyb032 Anti-Cystatin C Antibody (PAb) Polyclonal Sheep cystatin C antibody, work in immunoassay. 1 mg $705.00
Vpre-Wyb033 Recombinant human cystatin C Protein Recombinant human cystatin C protein (120aa) expressed in E. coli with no tag. E. coli 100 µg $395.00
Vpre-Wyb034 Standard Cystatin C Free Serum Cystatin C Protein free serum is derived from pooled normal human serum and can be used to prepare human CRP standards and calibrators. Pooled normal human serum 50 mL $888.00
Vpre-Wyb035 Anti-D-dimer Antibody (MAb) Human D-dimer antibody, derived from hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice. Hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice 1 mg $651.00
Vpre-Wyb036 Human D-dimer Protein Human D-dimer antigen, derived from human plasma. 100 µg $585.00
Vpre-Wyb037 Anti-Myoglobin Antibody (MAb) Human Myoglobin antibody, derived from hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice. Hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice 1 mg $512.00
Vpre-Wyb038 Human Myoglobin Protein Human Myoglobin Protein was derived from human heart tissue. Human heart tissue. 100 µg $378.00
Vpre-Wyb039 Standard Myoglobin Free Serum Myoglobin free serum is derived from pooled normal human serum and can be used to prepare human Myoglobin standards and calibrators. Pooled normal human serum 50 mL $888.00
Vpre-Wyb040 Anti-BNP Antibody (MAb) Human BNP antibody, derived from hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice. Hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice 1 mg $938.00
Vpre-Wyb041 Anti-NT-proBNP Antibody (MAb, Clone: 5B6) Human NT-proBNP antibody, derived from hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice. Hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice 1 mg $928.00
Vpre-Wyb042 Anti-NT-proBNP Antibody (MAb, Clone: 15F11) Human NT-proBNP antibody, derived from hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice. Hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice 1 mg $928.00
Vpre-Wyb043 Anti-NT-proBNP Antibody (MAb, Clone: 7B5) Human NT-proBNP antibody, derived from hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice. Hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice 1 mg $928.00
Vpre-Wyb044 Anti-NT-proBNP Antibody (MAb, Clone: 13G12) Human NT-proBNP antibody, derived from hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice. Hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice 1 mg $928.00
Vpre-Wyb045 Anti-NT-proBNP Antibody (MAb, Clone: 11D1) Human NT-proBNP antibody, derived from hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice. Hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice 1 mg $928.00
Vpre-Wyb046 Anti-NT-proBNP Antibody (MAb, Clone: 16E6) Human NT-proBNP antibody, derived from hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice. Hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice 1 mg $928.00
Vpre-Wyb047 Anti-NT-proBNP Antibody (MAb, Clone: 15D7) Human NT-proBNP antibody, derived from hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice. Hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice 1 mg $928.00
Vpre-Wyb048 Anti-NT-proBNP Antibody (MAb, Clone: 15C4) Human NT-proBNP antibody, derived from hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice. Hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice 1 mg $928.00
Vpre-Wyb049 Anti-NT-proBNP Antibody (MAb, Clone: 24E11) Human NT-proBNP antibody, derived from hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice. Hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice 1 mg $928.00
Vpre-Wyb050 Anti-NT-proBNP Antibody (MAb, Clone: 28F8) Human NT-proBNP antibody, derived from hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice. Hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice 1 mg $928.00
More +
For Research Use Only. We do not provide services or products directly for patients.


Inquiry Basket