SARS-CoV-2 (2019-nCoV) ORF9B Peptide Pool (CAT#: VPpt-Wyb010) Static Images Pdf

CAT Size Price Quantity  
VPpt-Wyb010
Static Images Notice For Research Use Only. We do not provide direct services or products for patients.

  • Sequence
  • MDPKISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK
  • Target
  • SARS-CoV-2
  • Storage
  • Store at -20 °C.
  • Introduction
  • The 2019 novel coronavirus, or "SARS-CoV-2", was discovered because of Wuhan virus pneumonia cases in 2019, and was named by the World Health Organization on January 12, 2020. It belongs to the beta genera of the Coronaviridae family, together with SARS coronavirus in 2003 and MERS coronavirus in 2012. The alignment between SARS-CoV-2 and 2003 SARS CoV has about 70% sequence similarity and 40% sequence similarity with MERS CoV. The coronavirus genome encodes a spike protein, an envelope protein, a membrane protein, and a nucleoprotein. Among them, spike protein is the most important surface membrane protein of coronavirus.
  • Alternative Names
  • 2019 novel coronavirus; SARS-CoV-2; Coronaviridae
Related products

Online Inquiry Static Images Notice For Research Use Only. We do not provide direct services or products for patients.


Static Img Product Inquiry Pic

Welcome! For price inquiries, please feel free to contact us through the form on the left side. We will get back to you as soon as possible.



24x7 CUSTOMER SERVICE

 
 Tel:
 Fax:
 Email:

  span cbl-addr-uk>
 Tel:
 Email:

 
 Tel:
 Email:
ISO 9001 Certified - Creative Biolabs Quality Management System
Inquiry Basket